Property Summary

NCBI Gene PubMed Count 13
Grant Count 27
R01 Count 18
Funding $3,020,132.2
PubMed Score 3.15
PubTator Score 11.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.424 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.100 0.001
medulloblastoma, large-cell 1.500 0.000
ovarian cancer 1.500 0.000

Gene RIF (7)

PMID Text
22427155 These results support a concept that downregulation of RREB-1 causes downregulation of ZIP3, which results in decreased zinc in pancreatic premalignant and carcinoma cells
21613827 Data show that the combination of concurrent zinc, ZIP3, and RREB-1 changes represent early events in the development of adenocarcinoma.
21053094 The metallothionein gene had a higher expression in the blood, when compared to zinc transporters ZnT-1, Zip-1, and Zip-3 (p=0.01 in obese patients.
19308021 Observational study of gene-disease association. (HuGE Navigator)
18279033 Gene expression regulation of ZIPs after zinc supplementation.
17550612 ZiP2 and Zip3 are down regulated in malignant cells
14525987 ZIP1, ZIP2 and ZIP3 may play cell-specific roles in zinc homeostasis rather than primary roles in the acquisition of dietary zinc

AA Sequence

MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCFNALLPAVREK      1 - 70
LQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLILTFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGG     71 - 140
ARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLAFALSAHSVFEGLALGLQEEGEKVVSLFVGVAVHETL    141 - 210
VAVALGISMARSAMPLRDAAKLAVTVSAMIPLGIGLGLGIESAQGVPGSVASVLLQGLAGGTFLFITFLE    211 - 280
ILAKELEEKSDRLLKVLFLVLGYTVLAGMVFLKW                                        281 - 314
//

Publication (19)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22427155 2012 Evidence for changes in RREB-1, ZIP3, and Zinc in the early development of pancreatic adenocarcinoma.
21613827 2011 Decreased zinc and downregulation of ZIP3 zinc uptake transporter in the development of pancreatic adenocarcinoma.
21053094 2011 Expression of the zinc transporters genes and metallothionein in obese women.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19308021 2009 Findings from bipolar disorder genome-wide association studies replicate in a Finnish bipolar family-cohort.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18279033 2008 Zinc supplementation in the elderly reduces spontaneous inflammatory cytokine release and restores T cell functions.
More...