Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.15
PubTator Score 11.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.5e-04
glioblastoma 1.100 1.1e-03
medulloblastoma, large-cell 1.500 1.7e-04
osteosarcoma 1.424 6.7e-06
ovarian cancer 1.500 7.3e-06

Gene RIF (7)

AA Sequence

MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCFNALLPAVREK      1 - 70
LQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLILTFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGG     71 - 140
ARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLAFALSAHSVFEGLALGLQEEGEKVVSLFVGVAVHETL    141 - 210
VAVALGISMARSAMPLRDAAKLAVTVSAMIPLGIGLGLGIESAQGVPGSVASVLLQGLAGGTFLFITFLE    211 - 280
ILAKELEEKSDRLLKVLFLVLGYTVLAGMVFLKW                                        281 - 314
//

Text Mined References (19)

PMID Year Title