Property Summary

NCBI Gene PubMed Count 15
PubMed Score 14.47
PubTator Score 4.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.743 0.000

Synonym

Accession Q9BRX9 B2RAF1 Q53FT6
Symbols MORG1

Gene

Gene RIF (6)

PMID Text
23439680 Morg1 facilitates Par6-aPKC binding to Crb3 for definition of apical identity of epithelial cells.
22491477 WDR83 and DHPS were capable of forming an RNA duplex at overlapping 3' untranslated regions and this duplex increased their mutual stability, which was required for the bidirectional regulation.
19429104 Morg1 expression is reduced in human brain tissue with ischemic damage. Reactive astrocytes in the surrounding brain tissue showed strong Morg1 expression.
16407229 Functional characterization of the homologous rat gene.
15118098 Component of a modular scaffold system that participates in the regulation of agonist-specific ERK signaling.
11991638 Includes the identification of this protein in C complex spliceosomes.

AA Sequence

MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEV      1 - 70
LDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRS     71 - 140
RRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSS    141 - 210
LDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVV    211 - 280
QSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG                                       281 - 315
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23439680 2013 The WD40 protein Morg1 facilitates Par6-aPKC binding to Crb3 for apical identity in epithelial cells.
22491477 2012 Bidirectional regulation between WDR83 and its natural antisense transcript DHPS in gastric cancer.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
19429104 2009 Reduced Morg1 expression in ischemic human brain.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17058450 2006 Comparative proteomic analysis of human leukemic cells with and without inducible expression of leukemogenic AML1-ETO protein.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16407229 2006 The novel WD-repeat protein Morg1 acts as a molecular scaffold for hypoxia-inducible factor prolyl hydroxylase 3 (PHD3).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...