Property Summary

NCBI Gene PubMed Count 18
PubMed Score 30.59
PubTator Score 1.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active ulcerative colitis -1.963 3.7e-03
acute myeloid leukemia -1.800 3.3e-03
Breast cancer 1.100 9.9e-09
breast carcinoma -1.400 7.3e-03
cystic fibrosis 1.100 1.9e-04
ductal carcinoma in situ -1.500 3.1e-02
facioscapulohumeral dystrophy 1.800 1.7e-03
Hydrolethalus syndrome -2.414 9.9e-03
interstitial cystitis -1.400 1.6e-03
intraductal papillary-mucinous neoplasm ... -1.400 2.0e-02
invasive ductal carcinoma -1.400 2.2e-02
medulloblastoma -1.100 2.1e-04
medulloblastoma, large-cell -1.100 7.4e-03
non primary Sjogren syndrome sicca 1.300 4.2e-02
non-small cell lung cancer 1.252 2.0e-14
ovarian cancer -2.300 5.3e-06
pancreatic ductal adenocarcinoma liver m... -1.618 4.2e-02
tuberculosis 1.400 1.4e-04

Gene RIF (4)

AA Sequence

MSFLQDPSFFTMGMWSIGAGALGAAALALLLANTDVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAKELW      1 - 70
EKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTEVKDFQPYFKGEIFLDEKKKF     71 - 140
YGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLL    141 - 210
SVLEAAKMIKPQTLASEKK                                                       211 - 229
//

Text Mined References (21)

PMID Year Title