Property Summary

NCBI Gene PubMed Count 16
PubMed Score 27.53
PubTator Score 1.39

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
26438880 results suggest that adipocyte-derived PAMM may suppress macrophage activation by inhibiting MAPK signalling pathway.
26402163 Antioxidant stress induces PAMM mRNA expression in human peripheral blood mononuclear cells .
20877624 Observational study of gene-disease association. (HuGE Navigator)
19951071 The PAMM is a redox regulatory protein that modulates osteoclast differentiation in vitro. PAMM expression may affect bone resorption in vivo and help to maintain bone mass.

AA Sequence

MSFLQDPSFFTMGMWSIGAGALGAAALALLLANTDVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAKELW      1 - 70
EKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTEVKDFQPYFKGEIFLDEKKKF     71 - 140
YGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLL    141 - 210
SVLEAAKMIKPQTLASEKK                                                       211 - 229
//

Text Mined References (19)

PMID Year Title
26438880 2015 Adipocyte-derived PAMM suppresses macrophage inflammation by inhibiting MAPK signalling.
26402163 2015 A short report: PAMM, a novel antioxidant protein, induced by oxidative stress.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19951071 2010 PAMM: a redox regulatory protein that modulates osteoclast differentiation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
More...