Property Summary

NCBI Gene PubMed Count 16
PubMed Score 27.53
PubTator Score 1.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 2.00226525269976E-14
Breast cancer 3099 9.87805452996505E-9
ovarian cancer 8492 6.0803634008264E-7
tuberculosis 1563 2.83931479021911E-6
medulloblastoma 1524 2.07358325393293E-4
cystic fibrosis 1670 8.70119244136731E-4
interstitial cystitis 2299 0.00122274709817654
facioscapulohumeral dystrophy 286 0.00172531550086126
acute myeloid leukemia 785 0.00329053239408728
active ulcerative colitis 477 0.00366807254135158
breast carcinoma 1614 0.00733657899263593
medulloblastoma, large-cell 6234 0.00743365574895727
invasive ductal carcinoma 2950 0.00819630753999042
Hydrolethalus syndrome 128 0.00988692376486057
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0199085130958756
ductal carcinoma in situ 1745 0.0305978215519769
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0416622608978378
non primary Sjogren syndrome sicca 840 0.0423861216661243
Disease Target Count Z-score Confidence
Choledocholithiasis 13 3.287 1.6

Expression

Synonym

Accession Q9BRX8 B2RD81 Q6UW08 Q8N2K3 Q8NBK9 Q96JR0
Symbols PAMM
C10orf58

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG

Gene RIF (4)

PMID Text
26438880 results suggest that adipocyte-derived PAMM may suppress macrophage activation by inhibiting MAPK signalling pathway.
26402163 Antioxidant stress induces PAMM mRNA expression in human peripheral blood mononuclear cells .
20877624 Observational study of gene-disease association. (HuGE Navigator)
19951071 The PAMM is a redox regulatory protein that modulates osteoclast differentiation in vitro. PAMM expression may affect bone resorption in vivo and help to maintain bone mass.

AA Sequence

MSFLQDPSFFTMGMWSIGAGALGAAALALLLANTDVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAKELW      1 - 70
EKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTEVKDFQPYFKGEIFLDEKKKF     71 - 140
YGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLL    141 - 210
SVLEAAKMIKPQTLASEKK                                                       211 - 229
//

Text Mined References (19)

PMID Year Title
26438880 2015 Adipocyte-derived PAMM suppresses macrophage inflammation by inhibiting MAPK signalling.
26402163 2015 A short report: PAMM, a novel antioxidant protein, induced by oxidative stress.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19951071 2010 PAMM: a redox regulatory protein that modulates osteoclast differentiation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
More...