Property Summary

NCBI Gene PubMed Count 20
PubMed Score 20.41
PubTator Score 13.02

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BRX5 B2RDP3 E9PB21 Q9H870
Symbols PSF3

Gene

PDB

2E9X   2EHO   2Q9Q  

Gene RIF (10)

PMID Text
26291987 Psf3 expression was strongly correlated with tumor progression in non-small-cell lung cancer
25520251 Two downregulated genes, NDRG4 and GINS3, have been located in a genomic interval associated with cardiac repolarization in published GWASs and zebra fish knockout models
25403684 PSF3 expression plays an important role in the progression of colorectal cancer and acts as a factor significantly affecting the prognosis of patients.
23127337 a prognostic biomarker in lung adenocarcinoma
20059967 These results suggest that PSF3 is a potential biomarker for diagnosis of progression in colon cancer and could
19652097 This sensitized zebrafish screen identified 15 novel myocardial repolarization genes. Among these genes is GINS3, the human ortholog of which is a major locus in 2 concurrent human genome-wide association studies of QT interval.
19305408 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
17127213 expression of mammalian GINS is regulated by 17beta-Estradiol-stimulated estrogen receptor alpha, and PSF3 acts as a gene responsive to transcription factor E2F1
16990792 This paper describes work done in Schizosaccharomyces pombe.
12730134 This paper describes work done in Saccharomyces cerevisiae.

AA Sequence

MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPL      1 - 70
WLAKGLFDNKRRILSVELPKIYQEGWRTVFSADPNVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQ     71 - 140
TFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRK    141 - 210
FTDMED                                                                    211 - 216
//

Publication (23)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26291987 2015 Significant role of Psf3 expression in non-small-cell lung cancer.
25520251 2015 Adipose tissue gene expression and metabolic health of obese adults.
25403684 2014 Partner of Sld five 3: a potential prognostic biomarker for colorectal cancer.
23127337 2013 Psf3 is a prognostic biomarker in lung adenocarcinoma.
21269460 2011 Initial characterization of the human central proteome.
20059967 2010 PSF3 marks malignant colon cancer and has a role in cancer cell proliferation.
19652097 2009 Drug-sensitized zebrafish screen identifies multiple genes, including GINS3, as regulators of myocardial repolarization.
19305408 2009 Common variants at ten loci influence QT interval duration in the QTGEN Study.
17652513 2007 Crystal structure of the GINS complex and functional insights into its role in DNA replication.
More...