Property Summary

NCBI Gene PubMed Count 23
PubMed Score 18.25
PubTator Score 9.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ulcerative colitis 1819 3.0e-08
ovarian cancer 8520 4.1e-05
dermatomyositis 966 1.9e-04
astrocytic glioma 2597 2.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.600 2.9e-02
dermatomyositis 1.500 1.9e-04
ovarian cancer -1.600 4.1e-05
ulcerative colitis 1.300 3.0e-08

Gene RIF (12)

AA Sequence

MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVE      1 - 70
AIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAV     71 - 140
VMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASP    141 - 210
GFVREQFCDYLFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDD    211 - 280
FYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLH    281 - 350
VSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED                                       351 - 385
//

Text Mined References (32)

PMID Year Title