Property Summary

NCBI Gene PubMed Count 20
Grant Count 2
R01 Count 2
Funding $48,307.71
PubMed Score 15.75
PubTator Score 9.41

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.600 0.029
ulcerative colitis 1.300 0.000
ovarian cancer 2.700 0.000
dermatomyositis 1.500 0.000

Synonym

Accession Q9BRX2 Q9GZS6 Q9Y306
Symbols CGI-17
PRO1770

Gene

 Grant Application (2)

PDB

1X52  

Gene RIF (9)

PMID Text
23667253 The non-stop decay mechanism exists in mammalian cells and involves Hbs1, Dom34, and the exosome-Ski complex.
23435426 PELO is a novel regulator of HER-signalling.
22190034 HIV-1 Pol is identified to have a physical interaction with pelota homolog (PELO) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21448132 Pelota/Hbs1 induced dissociation of elongation complexes from ribosomes and release of peptidyl-tRNA, but only in the presence of ABCE1.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20406461 PELO is subcellularly localized at the actin cytoskeleton, interacts with HAX1, EIF3G and SRPX proteins and that this interaction occurs at the cytoskeleton; this interaction may facilitate PELO to detect and degrade aberrant mRNAs.
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17669516 thrombopoietin-induced in vitro differentiation of primary human cord blood mononuclear cells into megakaryocytes, we observed rapid, progressive CpG methylation of ITGA1, but not PELO or ITGA2.

AA Sequence

MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQVGDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVE      1 - 70
AIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAV     71 - 140
VMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASP    141 - 210
GFVREQFCDYLFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDD    211 - 280
FYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLH    281 - 350
VSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED                                       351 - 385
//

Publication (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23667253 2013 The Hbs1-Dom34 protein complex functions in non-stop mRNA decay in mammalian cells.
23509613 2013 Genome-wide association study of antiphospholipid antibodies.
23435426 2014 PELO negatively regulates HER receptor signalling and metastasis.
22020760 2012 Polymorphic markers associated with severe oxaliplatin-induced, chronic peripheral neuropathy in colon cancer patients.
21448132 2011 Dissociation by Pelota, Hbs1 and ABCE1 of mammalian vacant 80S ribosomes and stalled elongation complexes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...