Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.07
PubTator Score 3.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
medulloblastoma, large-cell 6234 8.30717697204764E-7
atypical teratoid / rhabdoid tumor 4369 1.10144461404316E-6
glioblastoma 5572 6.69572761345727E-5
psoriasis 6685 7.29796443382858E-5
osteosarcoma 7933 1.2566944882289E-4
ovarian cancer 8492 1.99483925014051E-4
group 4 medulloblastoma 1875 3.47412152902173E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.52189358019301E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00188957805122326
Breast cancer 3099 0.0270162221104319

Expression

  Differential Expression (10)

Synonym

Accession Q9BRV8 Q5TEZ7 Q5TEZ9 Q68DZ4 Q9H778
Symbols SIKE

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
23649622 Data indicate that suppressor of IKKepsilon (SIKE) inhibits TANK-binding kinase 1 (TBK1)-mediated phosphorylation of interferon regulatory factor 3 (IRF3), which is essential to type I interferon production.
16281057 Overexpression of SIKE inhibits virus- and Toll-like receptor 3-triggered interferon-stimulated response elements (ISRE) but not NF-kappa B activation.

AA Sequence

MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQYQEDASDMKDMSKYKPH      1 - 70
ILLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAKKAVDAEPVLKAHQSHSAEIES     71 - 140
QIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISSESLQARKENSMDTASQAIK       141 - 207
//

Text Mined References (13)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25743393 2015 CCM-3/STRIPAK promotes seamless tube extension through endocytic recycling.
23649622 2013 Mechanism of endogenous regulation of the type I interferon response by suppressor of I?B kinase epsilon (SIKE), a novel substrate of TANK-binding kinase 1 (TBK1).
18782753 2009 A PP2A phosphatase high density interaction network identifies a novel striatin-interacting phosphatase and kinase complex linked to the cerebral cavernous malformation 3 (CCM3) protein.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16281057 2005 SIKE is an IKK epsilon/TBK1-associated suppressor of TLR3- and virus-triggered IRF-3 activation pathways.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...