Property Summary

NCBI Gene PubMed Count 8
Grant Count 90
R01 Count 27
Funding $32,401,801.33
PubMed Score 159.50
PubTator Score 45.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.300 0.001
lung adenocarcinoma 1.208 0.000
non-inflammatory breast cancer 1.600 0.012
non-small cell lung carcinoma 1.300 0.000
ductal carcinoma in situ 1.200 0.002
invasive ductal carcinoma 1.400 0.000

Synonym

Accession Q9BRV3 Q5SR64 Q6IAK6 Q96DC5 Q9UHQ2 Q9UHQ3 HsSWEET1
Symbols SCP
slv
SWEET1
RAG1AP1
HsSWEET1

Gene

AA Sequence

MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILI      1 - 70
VVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVPNPEARLQQLGLFCSVFTISM     71 - 140
YLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWLFWKYPQ    141 - 210
EQDRNYWLLQT                                                               211 - 221
//

Text Mined References (12)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22451204 2012 Meta-analysis of Parkinson's disease: identification of a novel locus, RIT2.
21107422 2010 Sugar transporters for intercellular exchange and nutrition of pathogens.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...