Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.61
PubTator Score 9.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
Breast cancer 3099 3.16478979872386E-69
breast carcinoma 1614 2.46205442492381E-32
psoriasis 6685 1.18149946431447E-20
ovarian cancer 8492 8.9438383915108E-19
non-small cell lung cancer 2798 4.86811081769402E-12
Duchenne muscular dystrophy 602 1.24568726956132E-10
oligodendroglioma 2849 1.39981841511399E-10
juvenile dermatomyositis 1189 9.0684536419985E-10
atypical teratoid / rhabdoid tumor 4369 1.2105613093889E-7
autosomal dominant Emery-Dreifuss muscular dystrophy 499 3.2271169594129E-5
glioblastoma 5572 9.23670177872688E-5
cystic fibrosis 1670 1.16478463340367E-4
adult high grade glioma 2148 1.31185004673282E-4
Pick disease 1893 2.21516995961618E-4
Amyotrophic Lateral Sclerosis 432 2.82811589393612E-4
medulloblastoma, large-cell 6234 4.68645728040452E-4
invasive ductal carcinoma 2950 5.07794351388797E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.05433745202976E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.87628962790139E-4
fascioscapulohumeral muscular dystrophy 100 7.97208212287847E-4
Atopic dermatitis 944 8.78907693162949E-4
astrocytic glioma 2241 0.00681862188519825
adrenocortical adenoma 134 0.00924281748348832
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00956165418407629
limb girdle muscular dystrophy 2B 74 0.0109925639238066
ependymoma 2514 0.0185269376506593
aldosterone-producing adenoma 664 0.0194336052116788
adrenocortical carcinoma 1427 0.0199653431235962
ductal carcinoma in situ 1745 0.0293332291756718
group 3 medulloblastoma 2254 0.037610390704842

Expression

Synonym

Accession Q9BRU2 B3KSV2 Q96AT4 TCEA-like protein 7
Symbols WEX5
MPMGp800C04260Q003

Gene

PANTHER Protein Class (1)

  Ortholog (6)

Gene RIF (7)

PMID Text
23372750 Our study suggests that TCEAL7 might serve as a candidate tumor suppressor and a potential prognostic biomarker in gastric carcinogenesis.
20454512 alteration of TCEAL7 expression levels in recombination-based alternative lengthening of telomeres and telomerase-positive cells affects hTERT expression
19966855 TCEAL7 in the negative regulation of NF-kappaB signaling at the basal level by modulating transcriptional activity of NF-kappaB on its target gene promoters in ovarian cells.
19419758 TCEAL7 polymorphisms may play a role in the development of invasive serous ovarian cancers.
19419758 Observational study of gene-disease association. (HuGE Navigator)
18806825 A role for candidate tumor-suppressor gene TCEAL7 in the regulation of c-Myc activity, cyclin D1 levels and cellular transformation is reported.
15870691 TCEAL7 is a cell death regulatory protein that is frequently inactivated in ovarian cancers, and may function as a tumor suppressor.

AA Sequence

MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDEEMTREGDEME      1 - 70
RCLEEIRGLRKKFRALHSNHRHSRDRPYPI                                             71 - 100
//

Text Mined References (12)

PMID Year Title
23372750 2013 Decreased expression of transcription elongation factor A-like 7 is associated with gastric adenocarcinoma prognosis.
20454512 2010 TCEAL7 inhibition of c-Myc activity in alternative lengthening of telomeres regulates hTERT expression.
19966855 2010 TCEAL7, a putative tumor suppressor gene, negatively regulates NF-kappaB pathway.
19419758 2009 Polymorphisms in TCEAL7 and risk of epithelial ovarian cancer.
18806825 2008 A role for candidate tumor-suppressor gene TCEAL7 in the regulation of c-Myc activity, cyclin D1 levels and cellular transformation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15870691 2005 Epigenetic silencing of TCEAL7 (Bex4) in ovarian cancer.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...