Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.68
PubTator Score 9.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Gene RIF (7)

AA Sequence

MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDEEMTREGDEME      1 - 70
RCLEEIRGLRKKFRALHSNHRHSRDRPYPI                                             71 - 100
//

Text Mined References (13)

PMID Year Title