Property Summary

NCBI Gene PubMed Count 8
Grant Count 3
Funding $60,006
PubMed Score 17.00
PubTator Score 6.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 2.800 0.000
osteosarcoma 1.902 0.012
medulloblastoma, large-cell 1.100 0.000
non-small cell lung cancer 1.646 0.000
sonic hedgehog group medulloblastoma 1.200 0.000
psoriasis 1.100 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q9BRT9 B2R8H5 D3DSY0 Q8N648
Symbols SLD5

Gene

PDB

2E9X   2EHO   2Q9Q  

Gene RIF (2)

PMID Text
18854154 Knockdown of GINS complex subunit 4 (GINS4) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17417653 The C-terminal domains of the Sld5 and Psf1 subunits are connected by linker regions to the core complex, and the C-terminal domain of Sld5 is important for core complex assembly.

AA Sequence

MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKR      1 - 70
EDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESY     71 - 140
LKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKT    141 - 210
IAPLVASGAVQLI                                                             211 - 223
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
22540012 2012 Interactions of the human MCM-BP protein with MCM complex components and Dbf4.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20070258 2010 Structure and function of the GINS complex, a key component of the eukaryotic replisome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17652513 2007 Crystal structure of the GINS complex and functional insights into its role in DNA replication.
17611626 2007 Comprehensive expression profiling of tumor cell lines identifies molecular signatures of melanoma progression.
17557111 2007 Molecular architecture of the human GINS complex.
More...