Property Summary

NCBI Gene PubMed Count 9
PubMed Score 18.64
PubTator Score 6.37

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 2.800 5.5e-07
medulloblastoma, large-cell 1.100 1.3e-04
non-small cell lung cancer 1.646 2.1e-17
osteosarcoma 1.169 1.6e-02
ovarian cancer 1.100 3.0e-06
psoriasis 1.100 7.1e-10
sonic hedgehog group medulloblastoma 1.200 2.1e-06

Gene RIF (3)

AA Sequence

MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKR      1 - 70
EDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESY     71 - 140
LKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKT    141 - 210
IAPLVASGAVQLI                                                             211 - 223
//

Text Mined References (18)

PMID Year Title