Property Summary

NCBI Gene PubMed Count 10
PubMed Score 38.46
PubTator Score 7.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Bronchopneumonia 3 4.142 2.1

Expression

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MLPAVGSADEEEDPAEEDCPELVPIETTQSEEEEKSGLGAKIPVTIITGYLGAGKTTLLNYILTEQHSKR      1 - 70
VAVILNEFGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDSGLRAIENLMQKKGKFDYILLETTGL     71 - 140
ADPGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADAILINKTDLVPE    141 - 210
EDVKKLRTTIRSINGLGQILETQRSRVDLSNVLDLHAFDSLSGISLQKKLQHVPGTQPHLDQSIVTITFE    211 - 280
VPGNAKEEHLNMFIQNLLWEKNVRNKDNHCMEVIRLKGLVSIKDKSQQVIVQGVHELYDLEETPVSWKDD    281 - 350
TERTNRLVLLGRNLDKDILKQLFIATVTETEKQWTTRFQEDQVCT                             351 - 395
//

Text Mined References (12)

PMID Year Title