Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BRT7
Symbols C1orf97

Gene

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
24586304 N-Myc-mediated suppression of linc00467 gene transcription counterintuitively blocks N-Myc-mediated reduction in RD3 mRNA expression, and reduces neuroblastoma cell survival by inducing DKK1 expression
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDKKSTHRNPEDARAGKYEGKHKRKKRRKQNQNQHRSRHRSVTSFSSDDPMFPSSSSSSSGSQTDSSIED      1 - 70
AAKGKIKKKRREKTNKWEKRKDKI                                                   71 - 94
//

Text Mined References (6)

PMID Year Title
24586304 2014 The novel long noncoding RNA linc00467 promotes cell survival but is down-regulated by N-Myc.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.