Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BRT7
Symbols C1orf97

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MDKKSTHRNPEDARAGKYEGKHKRKKRRKQNQNQHRSRHRSVTSFSSDDPMFPSSSSSSSGSQTDSSIED      1 - 70
AAKGKIKKKRREKTNKWEKRKDKI                                                   71 - 94
//

Text Mined References (6)

PMID Year Title