Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.00
PubTator Score 14.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 5.4904230524431E-11
ovarian cancer 8492 7.75914896827471E-6
nasopharyngeal carcinoma 1056 0.00310221398299309
invasive ductal carcinoma 2950 0.00333705740290624
group 3 medulloblastoma 2254 0.0325067615966686
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.100 0.033
nasopharyngeal carcinoma 1.100 0.003
Breast cancer -1.300 0.000
invasive ductal carcinoma -1.100 0.003
ovarian cancer -2.000 0.000

Synonym

Accession Q9BRT6 Q3B766
Symbols hLLP
C12orf31

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

AA Sequence

MAKSLRSKWKRKMRAEKRKKNAPKEASRLKSILKLDGDVLMKDVQEIATVVVPKPKHCQEKMQCEVKDEK      1 - 70
DDMKMETDIKRNKKTLLDQHGQYPIWMNQRQRKRLKAKREKRKGKSKAKAVKVAKGLAW                71 - 129
//

Text Mined References (10)

PMID Year Title
26961175 2016 A transducible nuclear/nucleolar protein, mLLP, regulates neuronal morphogenesis and synaptic transmission.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.