Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.17
PubTator Score 14.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3577 5.5e-11
ovarian cancer 8519 7.8e-06
nasopharyngeal carcinoma 1058 3.1e-03
invasive ductal carcinoma 2950 3.3e-03
group 3 medulloblastoma 4104 3.3e-02
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0
Disease Target Count Z-score Confidence
Silver-Russell syndrome 39 3.945 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.300 5.5e-11
group 3 medulloblastoma 1.100 3.3e-02
invasive ductal carcinoma -1.100 3.3e-03
nasopharyngeal carcinoma 1.100 3.1e-03
ovarian cancer -2.000 7.8e-06

Synonym

Accession Q9BRT6 Q3B766
Symbols hLLP
C12orf31

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAKSLRSKWKRKMRAEKRKKNAPKEASRLKSILKLDGDVLMKDVQEIATVVVPKPKHCQEKMQCEVKDEK      1 - 70
DDMKMETDIKRNKKTLLDQHGQYPIWMNQRQRKRLKAKREKRKGKSKAKAVKVAKGLAW                71 - 129
//

Text Mined References (11)

PMID Year Title