Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.00
PubTator Score 14.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.100 0.033
nasopharyngeal carcinoma 1.100 0.003
Breast cancer -1.300 0.000
invasive ductal carcinoma -1.100 0.003
ovarian cancer -2.000 0.000

Synonym

Accession Q9BRT6 Q3B766
Symbols hLLP
C12orf31

Gene

AA Sequence

MAKSLRSKWKRKMRAEKRKKNAPKEASRLKSILKLDGDVLMKDVQEIATVVVPKPKHCQEKMQCEVKDEK      1 - 70
DDMKMETDIKRNKKTLLDQHGQYPIWMNQRQRKRLKAKREKRKGKSKAKAVKVAKGLAW                71 - 129
//

Text Mined References (10)

PMID Year Title
26961175 2016 A transducible nuclear/nucleolar protein, mLLP, regulates neuronal morphogenesis and synaptic transmission.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.