Property Summary

NCBI Gene PubMed Count 24
PubMed Score 19.56
PubTator Score 116.98

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 2.100 0.039
breast carcinoma 1.100 0.000
invasive ductal carcinoma 2.300 0.033
ovarian cancer 1.700 0.000

Synonym

Accession Q9BRT3
Symbols C35
ORB3
XTP4
RDX12
C17orf37

Gene

PDB

2LJK  

Gene RIF (14)

PMID Text
26827826 In conclusion, this study revealed that miR-26b suppresses NSCLC metastasis by targeting MIEN1 via NF-kappaB/MMP-9/VEGF pathways, implicating a potential prognostic biomarker and therapeutic target for NSCLC treatment.
26272794 MIEN1, a novel interactor of Annexin A2, promotes tumor cell migration by enhancing AnxA2 cell surface expression.
26173296 C35 might serve as a biomarker or therapeutic target for management of colorectal cancer.
25996585 MIEN1 expression not only positively correlates with oral cancer progression but also seems to be a critical molecular determinant in migration and invasion of oral cancer cells.
25406943 While MIEN1 is a direct target of miR-940, miR-940 alters MIEN1 RNA.
23880825 results suggest that DeltaNp73 might cooperate with C35 to promote tumour progression and contribute to cisplatin resistance in ovarian cancer cells.
23284973 Results suggest that MIEN1 may have an important regulatory role in phosphorylation of AKT with its redox potential.
21628459 prenylation is required for the function of the C17orf37 protein in cancer cells
21068479 Inhibition of C35 gene expression by small interfering RNA induces apoptosis of breast cancer cells.
19503095 Data strongly suggest C17orf37 overexpression in prostate cancer functionally enhances migration and invasion of tumor cells, and is an important target for cancer therapy.
More...

AA Sequence

MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEIN      1 - 70
GQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL                              71 - 115
//

Text Mined References (28)

PMID Year Title
26827826 2016 MicroRNA-26b suppresses the metastasis of non-small cell lung cancer by targeting MIEN1 via NF-?B/MMP-9/VEGF pathways.
26272794 2015 MIEN1, a novel interactor of Annexin A2, promotes tumor cell migration by enhancing AnxA2 cell surface expression.
26173296 2015 C35 is overexpressed in colorectal cancer and is associated tumor invasion and metastasis.
25996585 2015 MIEN1 promotes oral cancer progression and implicates poor overall survival.
25416956 2014 A proteome-scale map of the human interactome network.
25406943 2014 MicroRNA-940 suppresses prostate cancer migration and invasion by regulating MIEN1.
23880825 2013 The interaction between C35 and ?Np73 promotes chemo-resistance in ovarian cancer cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23284973 2012 Solution structure of the oncogenic MIEN1 protein reveals a thioredoxin-like fold with a redox-active motif.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...