Property Summary

NCBI Gene PubMed Count 27
PubMed Score 21.16
PubTator Score 116.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
breast carcinoma 1638 8.6e-14
ovarian cancer 8520 1.6e-04
invasive ductal carcinoma 2951 3.3e-02
Breast cancer 3578 3.9e-02
Disease Target Count Z-score Confidence
Retinitis pigmentosa 23 27 3.587 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 2.100 3.9e-02
breast carcinoma 1.100 8.6e-14
invasive ductal carcinoma 2.300 3.3e-02
ovarian cancer 1.700 1.6e-04

Gene RIF (17)

AA Sequence

MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEIN      1 - 70
GQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL                              71 - 115
//

Text Mined References (31)

PMID Year Title