Property Summary

NCBI Gene PubMed Count 14
PubMed Score 34.39
PubTator Score 17.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute myeloid leukemia -1.400 9.2e-03
adult high grade glioma -1.100 1.0e-04
Astrocytoma, Pilocytic -1.100 9.8e-07
atypical teratoid / rhabdoid tumor -1.400 1.2e-04
Breast cancer 1.400 2.6e-20
diabetes mellitus -1.100 1.2e-03
ductal carcinoma in situ 1.100 1.5e-04
ependymoma -1.100 1.2e-07
glioblastoma -1.600 1.1e-05
group 3 medulloblastoma 1.100 7.4e-03
invasive ductal carcinoma 1.400 5.5e-04
lung adenocarcinoma 1.700 5.7e-13
lung carcinoma 1.200 4.0e-19
medulloblastoma, large-cell -1.700 8.8e-06
non primary Sjogren syndrome sicca 1.100 1.9e-02
non-small cell lung cancer 1.170 2.1e-16
ovarian cancer 1.700 1.2e-04
subependymal giant cell astrocytoma 1.361 1.4e-02

Gene RIF (7)

AA Sequence

MAASRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKH      1 - 70
KYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA                   71 - 126
//

Text Mined References (17)

PMID Year Title