Property Summary

NCBI Gene PubMed Count 21
PubMed Score 28.48
PubTator Score 28.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
adult high grade glioma -1.300 5.2e-04
astrocytic glioma -1.500 6.4e-03
Astrocytoma, Pilocytic -1.500 2.7e-08
atypical teratoid / rhabdoid tumor -1.700 2.3e-06
breast carcinoma -2.000 1.5e-06
ductal carcinoma in situ -2.000 2.4e-04
ependymoma -2.000 9.4e-03
fibroadenoma -1.700 2.3e-03
glioblastoma -1.400 3.4e-07
group 3 medulloblastoma -2.900 7.3e-08
inflammatory breast cancer -1.500 2.0e-03
intraductal papillary-mucinous carcinoma... -1.400 1.4e-04
intraductal papillary-mucinous neoplasm ... -1.200 5.6e-03
invasive ductal carcinoma -1.692 3.8e-03
juvenile dermatomyositis 1.168 7.1e-06
lung adenocarcinoma -1.500 5.8e-06
lung carcinoma 1.200 4.9e-08
malignant mesothelioma -2.700 1.7e-08
medulloblastoma, large-cell -3.100 3.1e-05
non-small cell lung cancer 1.445 1.3e-07
oligodendroglioma -1.400 1.8e-13
osteosarcoma 3.247 4.2e-07
ovarian cancer 1.500 2.3e-03
pancreatic ductal adenocarcinoma liver m... -1.057 2.8e-02
Pick disease -1.400 1.3e-02
primitive neuroectodermal tumor -1.400 1.3e-03
progressive supranuclear palsy -1.700 2.0e-02
psoriasis -1.400 1.0e-09
subependymal giant cell astrocytoma -2.186 1.1e-02
ulcerative colitis 1.200 7.7e-04

Gene RIF (11)

AA Sequence

MAQSGGEARPGPKTAVQIRVAIQEAEDVDELEDEEEGAETRGAGDPARYLSPGWGSASEEEPSRGHSGTT      1 - 70
ASGGENEREDLEQEWKPPDEELIKKLVDQIEFYFSDENLEKDAFLLKHVRRNKLGYVSVKLLTSFKKVKH     71 - 140
LTRDWRTTAHALKYSVVLELNEDHRKVRRTTPVPLFPNENLPSKMLLVYDLYLSPKLWALATPQKNGRVQ    141 - 210
EKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVEAAIKAHEFMITES    211 - 280
QGKENMKAVLIGMKPPKKKPAKDKNHDEEPTASIHLNKSLNKRVEELQYMGDESSANSSSDPESNPTSPM    281 - 350
AGRRHAATNKLSPSGHQNLFLSPNASPCTSPWSSPLAQRKGVSRKSPLAEEGRLNCSTSPEIFRKCMDYS    351 - 420
SDSSVTPSGSPWVRRRRQAEMGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC    421 - 490
V//

Text Mined References (25)

PMID Year Title