Property Summary

Ligand Count 3
NCBI Gene PubMed Count 13
PubMed Score 7.38
PubTator Score 4.32

Knowledge Summary

Patent (1,257)

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy 1.044 1.8e-06
diabetes mellitus -1.100 3.1e-03
group 3 medulloblastoma 1.500 2.3e-04
osteosarcoma -1.192 1.1e-03

Gene RIF (6)

AA Sequence

MDYRRLLMSRVVPGQFDDADSSDSENRDLKTVKEKDDILFEDLQDNVNENGEGEIEDEEEEGYDDDDDDW      1 - 70
DWDEGVGKLAKGYVWNGGSNPQANRQTSDSSSAKMSTPADKVLRKFENKINLDKLNVTDSVINKVTEKSR     71 - 140
QKEADMYRIKDKADRATVEQVLDPRTRMILFKMLTRGIITEINGCISTGKEANVYHASTANGESRAIKIY    141 - 210
KTSILVFKDRDKYVSGEFRFRHGYCKGNPRKMVKTWAEKEMRNLIRLNTAEIPCPEPIMLRSHVLVMSFI    211 - 280
GKDDMPAPLLKNVQLSESKARELYLQVIQYMRRMYQDARLVHADLSEFNMLYHGGGVYIIDVSQSVEHDH    281 - 350
PHALEFLRKDCANVNDFFMRHSVAVMTVRELFEFVTDPSITHENMDAYLSKAMEIASQRTKEERSSQDHV    351 - 420
DEEVFKRAYIPRTLNEVKNYERDMDIIMKLKEEDMAMNAQQDNILYQTVTGLKKDLSGVQKVPALLENQV    421 - 490
EERTCSDSEDIGSSECSDTDSEEQGDHARPKKHTTDPDIDKKERKKMVKEAQREKRKNKIPKHVKKRKEK    491 - 560
TAKTKKGK                                                                  561 - 568
//

Text Mined References (21)

PMID Year Title