Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.95
PubTator Score 5.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.100 0.041
glioblastoma 1.500 0.001
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma 1.100 0.000
medulloblastoma, large-cell 1.100 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q9BRR6 Q49AU7 Q8NBI1 Q8WZ90 Q96NF8 Q9H0A7 ADP-GK
Symbols ADP-GK
2610017G09Rik

Gene

PANTHER Protein Class (2)

Gene RIF (6)

PMID Text
26555263 ADPGK is substrate inhibited by high glucose concentration and shows high specificity for glucose, with no activity for other sugars, as determined by NMR spectroscopy, including 2-deoxyglucose
23799003 ADPGK can contribute to tumour cell survival under conditions of high glycolytic dependence.
22219026 human ADPGK(ADP-dependent glucokinase) catalyses ADP-dependent phosphorylation of glucose in vitro, but despite its high expression in human tumour cell lines it appears not to make a quantifiable contribution to glycolysis under the conditions evaluated.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19903754 Glucose and insulin response to oral glucose is higher in GCK(261) carriers, indicating clinical heterogeneity in GCK maturity diabetes carriers.
19309449 The presence of mild persistent hyperglycemia in any patient without autoantibodies should lead to genetic analysis of glucokinase, particularly if there is a positive family history.

AA Sequence

MALWRGSAYAGFLALAVGCVFLLEPELPGSALRSLWSSLCLGPAPAPPGPVSPEGRLAAAWDALIVRPVR      1 - 70
RWRRVAVGVNACVDVVLSGVKLLQALGLSPGNGKDHSILHSRNDLEEAFIHFMGKGAAAERFFSDKETFH     71 - 140
DIAQVASEFPGAQHYVGGNAALIGQKFAANSDLKVLLCGPVGPKLHELLDDNVFVPPESLQEVDEFHLIL    141 - 210
EYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLE    211 - 280
VVTSISDIPTGIPVHLELASMTNRELMSSIVHQQVFPAVTSLGLNEQELLFLTQSASGPHSSLSSWNGVP    281 - 350
DVGMVSDILFWILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETI    351 - 420
DTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFY    421 - 490
SEVHPHY                                                                   491 - 497
//

Publication (19)

PMID Year Title
26555263 2016 The Structural and Functional Characterization of Mammalian ADP-dependent Glucokinase.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23799003 2013 Zinc finger nuclease mediated knockout of ADP-dependent glucokinase in cancer cell lines: effects on cell survival and mitochondrial oxidative metabolism.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23168256 2012 T cell activation is driven by an ADP-dependent glucokinase linking enhanced glycolysis with mitochondrial reactive oxygen species generation.
22219026 2012 Expression and role in glycolysis of human ADP-dependent glucokinase.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19903754 2010 Clinical heterogeneity in monogenic diabetes caused by mutations in the glucokinase gene (GCK-MODY).
More...