Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.82
PubTator Score 5.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Gout 106 0.0 2.4

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.100 4.1e-02
atypical teratoid / rhabdoid tumor 1.200 2.3e-06
glioblastoma 1.500 7.4e-04
medulloblastoma 1.100 3.9e-04
medulloblastoma, large-cell 1.100 6.8e-05
ovarian cancer 1.100 5.3e-05

Gene RIF (6)

AA Sequence

MALWRGSAYAGFLALAVGCVFLLEPELPGSALRSLWSSLCLGPAPAPPGPVSPEGRLAAAWDALIVRPVR      1 - 70
RWRRVAVGVNACVDVVLSGVKLLQALGLSPGNGKDHSILHSRNDLEEAFIHFMGKGAAAERFFSDKETFH     71 - 140
DIAQVASEFPGAQHYVGGNAALIGQKFAANSDLKVLLCGPVGPKLHELLDDNVFVPPESLQEVDEFHLIL    141 - 210
EYQAGEEWGQLKAPHANRFIFSHDLSNGAMNMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLE    211 - 280
VVTSISDIPTGIPVHLELASMTNRELMSSIVHQQVFPAVTSLGLNEQELLFLTQSASGPHSSLSSWNGVP    281 - 350
DVGMVSDILFWILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETI    351 - 420
DTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFY    421 - 490
SEVHPHY                                                                   491 - 497
//

Text Mined References (19)

PMID Year Title