Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 1.14561552389299E-17
pilocytic astrocytoma 3086 1.71080907185873E-11
lung adenocarcinoma 2714 6.1352029138632E-9
adult high grade glioma 2148 7.07941402876461E-9
atypical teratoid / rhabdoid tumor 4369 1.67659483444446E-5
interstitial cystitis 2299 2.30835843270224E-5
glioblastoma 5572 2.6887091659097E-5
ovarian cancer 8492 3.05508130460646E-5
nasopharyngeal carcinoma 1056 3.26764679408332E-5
breast carcinoma 1614 4.40213559936621E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.15226327931893E-4
cystic fibrosis 1670 1.5417781753422E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.3589135571616E-4
astrocytic glioma 2241 5.89586879199611E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.51629963773176E-4
ductal carcinoma in situ 1745 6.63323343777565E-4
medulloblastoma, large-cell 6234 7.71609069229661E-4
sonic hedgehog group medulloblastoma 1482 9.83942026042311E-4
lung cancer 4473 0.00192721665638057
invasive ductal carcinoma 2950 0.00232104980655954
oligodendroglioma 2849 0.00470909520748166
primitive neuroectodermal tumor 3031 0.00900544211255457
subependymal giant cell astrocytoma 2287 0.0109419079483762
fibroadenoma 557 0.0198647179365312
urothelial carcinoma 318 0.0276336405676532

Expression

Synonym

Accession Q9BRR3 Q49AQ4
Symbols C9orf125

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

AA Sequence

MSTSTSPAAMLLRRLRRLSWGSTAVQLFILTVVTFGLLAPLACHRLLHSYFYLRHWHLNQMSQEFLQQSL      1 - 70
KEGEAALHYFEELPSANGSVPIVWQATPRPWLVITIITVDRQPGFHYVLQVVSQFHRLLQQCGPQCEGHQ     71 - 140
LFLCNVERSVSHFDAKLLSKYVPVANRYEGTEDDYGDDPSTNSFEKEKQDYVYCLESSLQTYNPDYVLMV    141 - 210
EDDAVPEEQIFPVLEHLLRARFSEPHLRDALYLKLYHPERLQHYINPEPMRILEWVGVGMLLGPLLTWIY    211 - 280
MRFASRPGFSWPVMLFFSLYSMGLVELVGRHYFLELRRLSPSLYSVVPASQCCTPAMLFPAPAARRTLTY    281 - 350
LSQVYCHKGFGKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFHPSLL                     351 - 403
//

Text Mined References (6)

PMID Year Title
25352737 2014 Electronic medical records and genomics (eMERGE) network exploration in cataract: several new potential susceptibility loci.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.