Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.15
PubTator Score 7.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 8.9e-06
group 3 medulloblastoma 1.400 4.8e-05
lung cancer 1.200 1.3e-02
medulloblastoma, large-cell 1.100 8.3e-04
non primary Sjogren syndrome sicca -1.300 1.7e-02
osteosarcoma -2.190 1.4e-07
primitive neuroectodermal tumor 1.300 2.5e-04

Gene RIF (5)

AA Sequence

MARELSESTALDAQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGSRERFRGFRYPEAAGPREALSRLREL      1 - 70
CRQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPESGEEVVVLLEYLERQLDEPAPQVSGVDQ     71 - 140
GQELLCCKMALLTPAPGSQSSQFQLMKALLKHESVGSQPLQDRVLQVPVLAHGGCCREDKVVASRLTPES    141 - 210
QGLLKVEDVALTLTPEWTQQDSSQGNLCRDEKQENHGSLVSLGDEKQTKSRDLPPAEELPEKEHGKISCH    211 - 280
LREDIAQIPTCAEAGEQEGRLQRKQKNATGGRRHICHECGKSFAQSSGLSKHRRIHTGEKPYECEECGKA    281 - 350
FIGSSALVIHQRVHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHRIH    351 - 420
TGEKPYQCSMCGKAFRRSSHLLRHQRIHTGDKNVQEPEQGEAWKSRMESQLENVETPMSYKCNECERSFT    421 - 490
QNTGLIEHQKIHTGEKPYQCNACGKGFTRISYLVQHQRSHVGKNILSQ                          491 - 538
//

Text Mined References (19)

PMID Year Title