Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.15
PubTator Score 7.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q9BRR0 B2R8W2 B3KVC0 H7BXX1 Q5VXH3 Q92972 Q9H4T3
Symbols ZF47
Zfp47
ZFP306
ZNF306
ZNF309
zfp-47
ZSCAN13
ZSCAN35
dJ874C20.1
dJ874C20.1.

Gene

PANTHER Protein Class (1)

Gene RIF (4)

PMID Text
23434374 Suggest ZKSCAN3 as an autophagy master switch regulating the expression of a transcriptional network of genes integral to autophagy and lysosome biogenesis/function.
21057542 ZKSCAN3 induction represents a mechanism by which myeloma cells can induce cyclin D2 dysregulation and contribute to disease pathogenesis.
18940803 ZKSCAN3 regulates the expression of several genes favoring tumor progression including integrin beta 4 and VEGF
18519692 ZKSCAN3 adds to an expanding set of encoded products contributing to the progression of colorectal cancer

AA Sequence

MARELSESTALDAQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGSRERFRGFRYPEAAGPREALSRLREL      1 - 70
CRQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPESGEEVVVLLEYLERQLDEPAPQVSGVDQ     71 - 140
GQELLCCKMALLTPAPGSQSSQFQLMKALLKHESVGSQPLQDRVLQVPVLAHGGCCREDKVVASRLTPES    141 - 210
QGLLKVEDVALTLTPEWTQQDSSQGNLCRDEKQENHGSLVSLGDEKQTKSRDLPPAEELPEKEHGKISCH    211 - 280
LREDIAQIPTCAEAGEQEGRLQRKQKNATGGRRHICHECGKSFAQSSGLSKHRRIHTGEKPYECEECGKA    281 - 350
FIGSSALVIHQRVHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHRIH    351 - 420
TGEKPYQCSMCGKAFRRSSHLLRHQRIHTGDKNVQEPEQGEAWKSRMESQLENVETPMSYKCNECERSFT    421 - 490
QNTGLIEHQKIHTGEKPYQCNACGKGFTRISYLVQHQRSHVGKNILSQ                          491 - 538
//

Publication (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23434374 2013 ZKSCAN3 is a master transcriptional repressor of autophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22531714 2012 The zinc finger transcription factor ZKSCAN3 promotes prostate cancer cell migration.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21057542 2011 Evidence of a role for the novel zinc-finger transcription factor ZKSCAN3 in modulating Cyclin D2 expression in multiple myeloma.
18940803 2008 Unbiased screening for transcriptional targets of ZKSCAN3 identifies integrin beta 4 and vascular endothelial growth factor as downstream targets.
18519692 2008 The previously undescribed ZKSCAN3 (ZNF306) is a novel "driver" of colorectal cancer progression.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...