Property Summary

NCBI Gene PubMed Count 19
PubMed Score 14.87
PubTator Score 13.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma -1.400 9.4e-03
ductal carcinoma in situ -2.800 1.6e-04
fibroadenoma -2.300 3.0e-02
invasive ductal carcinoma -2.100 7.3e-03
lung adenocarcinoma 1.100 1.0e-05
non-small cell lung cancer 1.036 6.6e-10
pancreatic ductal adenocarcinoma liver m... -1.395 2.9e-02

 MGI Phenotype (1)

Protein-protein Interaction (8)

Gene RIF (11)

AA Sequence

MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYS      1 - 70
VTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQ     71 - 140
RSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVS    141 - 210
NLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNV    211 - 280
YAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLM    281 - 350
VRLTKSRDLFVSTSWKTMRQSPP                                                   351 - 373
//

Text Mined References (23)

PMID Year Title