Property Summary

NCBI Gene PubMed Count 19
PubMed Score 16.21
PubTator Score 13.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.395 0.029
non-small cell lung cancer 1.036 0.000
breast carcinoma -1.400 0.009
fibroadenoma -2.300 0.030
lung adenocarcinoma 1.100 0.000
ductal carcinoma in situ -2.800 0.000
invasive ductal carcinoma -2.100 0.007

Synonym

Accession Q9BRQ8 B3KXI0 Q63Z39
Symbols AMID
PRG3

Gene

Gene RIF (11)

PMID Text
26063804 AIF and its family member protein, AMID, are rotenone-sensitive NADH:ubiquinone oxidoreductases (of the NDH-2 type).
25244912 HUHS1015 increased nuclear localization of apoptosis-inducing factor-homologous mitochondrion-associated inducer of death (AMID).
20877624 Observational study of gene-disease association. (HuGE Navigator)
20635389 Observational study of gene-disease association. (HuGE Navigator)
19270026 Observational study of gene-disease association. (HuGE Navigator)
17711848 AIF-M2 lessens survival cell signaling in the presence of foreign (e.g. bacterial and (retro)viral) cytosolic DNA, thus contributing to the onset of apoptosis
17347867 study of cellular localization of the endonuclease G, AIF & AMID during apoptosis using bioinformatics and image analysis
15958387 Reasults establish a link between coenzyme and DNA binding that likely impacts on the physiological role of AMID in cellular apoptosis.
15273740 AMID is a p53-downstream gene involved in tumorigenesis.
12135761 encodes a homologue of the apoptosis-inducing factor
More...

AA Sequence

MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYS      1 - 70
VTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQ     71 - 140
RSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVS    141 - 210
NLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNV    211 - 280
YAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLM    281 - 350
VRLTKSRDLFVSTSWKTMRQSPP                                                   351 - 373
//

Text Mined References (23)

PMID Year Title
26063804 2015 Apoptosis-inducing Factor (AIF) and Its Family Member Protein, AMID, Are Rotenone-sensitive NADH:Ubiquinone Oxidoreductases (NDH-2).
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25244912 2015 HUHS1015 induces necroptosis and caspase-independent apoptosis of MKN28 human gastric cancer cells in association with AMID accumulation in the nucleus.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20635389 2011 Common alleles in candidate susceptibility genes associated with risk and development of epithelial ovarian cancer.
20213681 2010 Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system.
19270026 2009 Functional complementation studies identify candidate genes and common genetic variants associated with ovarian cancer survival.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...