Property Summary

NCBI Gene PubMed Count 29
Grant Count 32
R01 Count 28
Funding $2,462,992.04
PubMed Score 34.13
PubTator Score 35.41

Knowledge Summary

Patent

No data available

Expression

Gene RIF (22)

PMID Text
26445441 Overall high Orai3/Orai1 ratios in human prostate epithelial cells and androgen-insensitive cancer cells contribute to their ROS resistance and thereby may have a share in making the prostate one of the most prominent cancer susceptible organs
25791427 Orai3 down-tunes efficient STIM1 gating when in a heteromeric complex with Orai1.
24954132 Suggest disrupted dynamic equilibrium of channel-forming ORAI proteins as an oncogenic mechanism in prostate cancer.
24909327 A channel chimera of Orai3 with the N terminus of Orai1 was able to couple local Ca(2+) entry to NFAT activation, identifying the N-terminal domain of Orai1 as central to Ca(2+) nanodomain-transcription coupling.
24603752 The higher amplitude of store-operated Ca2+ entry was associated to the over-expression for Stim2, Orai2-3, and TRPC1 while Stim2 levels remained constant and Stim1, Orai1, Orai3, TRPC1 and TRPC4 proteins were over-expressed in primary myelofibrosis.
24321771 Orai1 and Orai3 proteins are more important than calcium influx to control cell proliferation.
24058448 Orai3 constitutes a native store-operated calcium entry pathway in non small cell lung adenocarcinoma that controls cell proliferation and cell cycle progression, likely via Akt pathway.
23266555 High ORAI3 expression is associated with breast cancer.
22993197 data establish Orai3 as an ERalpha-regulated channel and a potential selective therapeutic target for ERalpha(+) breast cancers
21724845 the N-terminal conserved region plays a multifaceted role in Orai3 current gating with distinct structural requirements for STIM1- and 2-APB-stimulated activation.
More...

AA Sequence

MKGGEGDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAKLKASSRTSAL      1 - 70
LSGFAMVAMVEVQLESDHEYPPGLLVAFSACTTVLVAVHLFALMVSTCLLPHIEAVSNIHNLNSVHQSPH     71 - 140
QRLHRYVELAWGFSTALGTFLFLAEVVLVGWVKFVPIGAPLDTPTPMVPTSRVPGTLAPVATSLSPASNL    141 - 210
PRSSASAAPSQAEPACPPRQACGGGGAHGPGWQAAMASTAIMVPVGLVFVAFALHFYRSLVAHKTDRYKQ    211 - 280
ELEELNRLQGELQAV                                                           281 - 295
//

Publication (29)

PMID Year Title
26956485 2016 A calcium-redox feedback loop controls human monocyte immune responses: The role of ORAI Ca2+ channels.
26718630 2016 Orai channel-mediated Ca2+ signals in vascular and airway smooth muscle.
26445441 2015 Differential Redox Regulation of Ca²? Signaling and Viability in Normal and Malignant Prostate Cells.
25791427 2015 Facilitation of Orai3 targeting and store-operated function by Orai1.
24954132 2014 Remodeling of channel-forming ORAI proteins determines an oncogenic switch in prostate cancer.
24909327 2014 Dynamic assembly of a membrane signaling complex enables selective activation of NFAT by Orai1.
24603752 2014 Enhanced expression of Stim, Orai, and TRPC transcripts and proteins in endothelial progenitor cells isolated from patients with primary myelofibrosis.
24321771 2014 Are Orai1 and Orai3 channels more important than calcium influx for cell proliferation?
24058448 2013 Orai3 constitutes a native store-operated calcium entry that regulates non small cell lung adenocarcinoma cell proliferation.
23890118 2013 The neglected CRAC proteins: Orai2, Orai3, and STIM2.
More...