Property Summary

NCBI Gene PubMed Count 29
PubMed Score 36.62
PubTator Score 35.41

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BRQ5 Q96BI8
Symbols TMEM142C

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (23)

AA Sequence

MKGGEGDAGEQAPLNPEGESPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAKLKASSRTSAL      1 - 70
LSGFAMVAMVEVQLESDHEYPPGLLVAFSACTTVLVAVHLFALMVSTCLLPHIEAVSNIHNLNSVHQSPH     71 - 140
QRLHRYVELAWGFSTALGTFLFLAEVVLVGWVKFVPIGAPLDTPTPMVPTSRVPGTLAPVATSLSPASNL    141 - 210
PRSSASAAPSQAEPACPPRQACGGGGAHGPGWQAAMASTAIMVPVGLVFVAFALHFYRSLVAHKTDRYKQ    211 - 280
ELEELNRLQGELQAV                                                           281 - 295
//

Text Mined References (29)

PMID Year Title