Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.11
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 3.9e-04
atypical teratoid / rhabdoid tumor 2.900 1.0e-05
cystic fibrosis -1.090 6.2e-04
ependymoma 5.000 1.1e-20
glioblastoma 1.800 3.2e-04
interstitial cystitis -1.100 3.3e-03
intraductal papillary-mucinous neoplasm ... 2.300 1.7e-03
medulloblastoma 1.300 1.2e-02
nasopharyngeal carcinoma -3.000 9.0e-07
osteosarcoma 1.314 3.2e-02
pediatric high grade glioma 2.100 2.4e-05
pituitary cancer 1.100 9.4e-04
primitive neuroectodermal tumor 2.800 3.5e-04

AA Sequence

MATGELGDLGGYYFRFLPQKTFQSLSSKEITSRLRQWSMLGRIKAQAFGFDQTFQSYRKDDFVMAFFKDP      1 - 70
NVIPNLKLLSDSSGQWIILGTEVKKIEAINVPCTQLSMSFFHRLYDEDIVRDSGHIVKCLDSFCDPFLIS     71 - 140
DELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYLETTKLIYKDLVSVRKNPQT    141 - 210
KKIQITSSVFKVSAYDSAGMCYPSAKNHEQTFSYFIVDPIRRHLHVLYHCYGVGDMS                 211 - 267
//

Text Mined References (4)

PMID Year Title