Property Summary

NCBI Gene PubMed Count 17
PubMed Score 147.38
PubTator Score 3.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 6.5e-06
Disease Target Count Z-score Confidence
Cavernous hemangioma 11 4.097 2.0
Epulis 3 3.123 1.6
Cancer 2499 3.066 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 6.5e-06

Gene RIF (2)

AA Sequence

MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAP      1 - 70
VTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASD     71 - 140
QPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL          141 - 204
//

Text Mined References (26)

PMID Year Title