Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.55
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -1.200 3.1e-02
medulloblastoma, large-cell 1.200 1.4e-04
non primary Sjogren syndrome sicca 1.200 1.6e-02
non-small cell lung cancer 1.202 4.6e-16
osteosarcoma -1.087 6.2e-04

 GO Component (2)

 GO Process (1)

 Compartment GO Term (1)

Gene RIF (5)

AA Sequence

MAAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSP      1 - 70
FHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSP     71 - 140
QFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSL    141 - 210
LRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPT    211 - 280
SEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQE    281 - 350
DPDELLFK                                                                  351 - 358
//

Text Mined References (13)

PMID Year Title