Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.55
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.087 0.001
medulloblastoma, large-cell 1.200 0.000
non-small cell lung cancer 1.202 0.000
non primary Sjogren syndrome sicca 1.200 0.016
acute myeloid leukemia -1.200 0.031

Gene RIF (4)

PMID Text
18854154 Knockdown of programmed cell death 2-like (PDCD2L) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18486760 Overexpression of PDCD2-like gene attenutates TNF-alpha release in Daudi cells
17393540 MGC13096 over-expression restrained proliferation of HEK293T cells. DNA/flow cytometry analysis showed that the over-expression of MGC13096 severely delays cell cycle progression at S phase.
16311922 To study the role of PDCD2_C domain in apoptosis, the cDNAs of two isoforms of PDCD2 and MGC13096 were cloned. PDCD2 (NM_002598) was over expressed when endothelial cells treated with leukotriene D4 or natural killer cells were activated by IL-2.

AA Sequence

MAAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSP      1 - 70
FHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSP     71 - 140
QFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSL    141 - 210
LRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPT    211 - 280
SEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQE    281 - 350
DPDELLFK                                                                  351 - 358
//

Text Mined References (12)

PMID Year Title
25566315 2014 Analysis of two domains with novel RNA-processing activities throws light on the complex evolution of ribosomal RNA biogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
18486760 Overexpression of the PDCD2-like gene results in inhibited TNF-alpha production in activated Daudi cells.
17393540 The novel MGC13096 protein is correlated with proliferation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16311922 2005 Cloning of cDNAs with PDCD2(C) domain and their expressions during apoptosis of HEK293T cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...