Property Summary

NCBI Gene PubMed Count 4
Grant Count 1
Funding $6,913
PubMed Score 5.99
PubTator Score 3.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.352 0.002
psoriasis -1.100 0.011
osteosarcoma -1.538 0.000
glioblastoma -1.100 0.000
medulloblastoma, large-cell -1.100 0.000
subependymal giant cell astrocytoma -1.745 0.022
Pick disease -1.200 0.001
ovarian cancer 2.000 0.002
dermatomyositis 1.800 0.000

Gene RIF (1)

PMID Text
16642435 Our approach yielded 26 candidate genes differentially expressed between patients (Osteoarthritis) and controls. BLP2 and CIAS1 seem to be trans-regulated, as the absence of allelic expression imbalances suggests.

AA Sequence

MAGGVLPLRGLRALCRVLLFLSQFCILSGGEQSQALAQSIKDPGPTRTFTVVPRAAESTEIPPYVMKCPS      1 - 70
NGLCSRLPADCIDCTTNFSCTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTN     71 - 140
STSCMTVSCPRQRYPANCTVRDHVHCLGNRTFPKMLYCNWTGGYKWSTALALSITLGGFGADRFYLGQWR    141 - 210
EGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI                                     211 - 247
//

Text Mined References (7)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16642435 2006 Cis- and trans-acting gene regulation is associated with osteoarthritis.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278849 2001 beta -Amyloid peptide-induced apoptosis regulated by a novel protein containing a g protein activation module.