Property Summary

NCBI Gene PubMed Count 4
PubMed Score 5.99
PubTator Score 3.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 3.68523328709684E-5
glioblastoma 5572 9.59333603564706E-5
medulloblastoma, large-cell 6234 1.633268995887E-4
dermatomyositis 967 2.08992831419129E-4
Pick disease 1893 6.26331456483249E-4
ovarian cancer 8492 0.00166566109887566
Multiple myeloma 1328 0.00221705343261324
psoriasis 6685 0.0105114777170478
subependymal giant cell astrocytoma 2287 0.0215507518116204
Disease Target Count Z-score Confidence
Angelman syndrome 38 3.125 1.6

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.352 0.002
psoriasis -1.100 0.011
osteosarcoma -1.538 0.000
glioblastoma -1.100 0.000
medulloblastoma, large-cell -1.100 0.000
subependymal giant cell astrocytoma -1.745 0.022
Pick disease -1.200 0.001
ovarian cancer 2.000 0.002
dermatomyositis 1.800 0.000

Synonym

Accession Q9BRN9 B2RDK9 Q9H046 Q9H651
Symbols BLP2

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (1)

PMID Text
16642435 Our approach yielded 26 candidate genes differentially expressed between patients (Osteoarthritis) and controls. BLP2 and CIAS1 seem to be trans-regulated, as the absence of allelic expression imbalances suggests.

AA Sequence

MAGGVLPLRGLRALCRVLLFLSQFCILSGGEQSQALAQSIKDPGPTRTFTVVPRAAESTEIPPYVMKCPS      1 - 70
NGLCSRLPADCIDCTTNFSCTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTN     71 - 140
STSCMTVSCPRQRYPANCTVRDHVHCLGNRTFPKMLYCNWTGGYKWSTALALSITLGGFGADRFYLGQWR    141 - 210
EGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI                                     211 - 247
//

Text Mined References (7)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16642435 2006 Cis- and trans-acting gene regulation is associated with osteoarthritis.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278849 2001 beta -Amyloid peptide-induced apoptosis regulated by a novel protein containing a g protein activation module.