Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.49
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.700 0.000
osteosarcoma 1.720 0.001
non-small cell lung cancer -1.030 0.000
lung adenocarcinoma -1.100 0.000
Pick disease 1.900 0.000
ulcerative colitis 1.300 0.000
ovarian cancer -2.100 0.000

Synonym

Accession Q9BRL7 O95152 Q68CX3 Q6UW18
Symbols SEC22L3

Gene

AA Sequence

MSVIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHFSSFGDVAC      1 - 70
MAICSCQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEK     71 - 140
IQEELKLQPPAVLTLEDTDVANGVMNGHTPMHLEPAPNFRMEPVTALGILSLILNIMCAALNLIRGVHLA    141 - 210
EHSLQVAHEEIGNILAFLVPFVACIFQCYLYLFYSPARTMKVVLMLLFICLGNMYLHGLRNLWQILFHIG    211 - 280
VAFLSSYQILTRQLQEKQSDCGV                                                   281 - 303
//

Text Mined References (9)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9501016 1998 Hsec22c: a homolog of yeast Sec22p and mammalian rsec22a and msec22b/ERS-24.