Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.99
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
lung adenocarcinoma -1.100 2.9e-15
non-small cell lung cancer -1.030 2.9e-20
osteosarcoma -1.343 3.4e-04
ovarian cancer -2.100 1.2e-09
Pick disease 1.900 1.1e-04
Rheumatoid arthritis 1.700 1.7e-04
ulcerative colitis 1.200 1.7e-05

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (1)

AA Sequence

MSVIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHFSSFGDVAC      1 - 70
MAICSCQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEK     71 - 140
IQEELKLQPPAVLTLEDTDVANGVMNGHTPMHLEPAPNFRMEPVTALGILSLILNIMCAALNLIRGVHLA    141 - 210
EHSLQVAHEEIGNILAFLVPFVACIFQCYLYLFYSPARTMKVVLMLLFICLGNMYLHGLRNLWQILFHIG    211 - 280
VAFLSSYQILTRQLQEKQSDCGV                                                   281 - 303
//

Text Mined References (10)

PMID Year Title