Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 3.10

Knowledge Summary

Patent

No data available

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
25496916 Serine/arginine-rich splicing factor 8 (SRSF8) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS

AA Sequence

MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQD      1 - 70
AEAAMDGAELDGRELRVQVARYGRRDLPRSRQGEPRGRSRGGGYGRRSRSYGRRSRSPRRRHRSRSRGPS     71 - 140
CSRSRSRSRYRGSRYSRSPYSRSPYSRSRYSRSPYSRSRYRESRYGGSHYSSSGYSNSRYSRYHSSRSHS    141 - 210
KSGSSTSSRSASTSKSSSARRSKSSSVSRSRSRSRSSSMTRSPPRVSKRKSKSRSRSKRPPKSPEEEGQM    211 - 280
SS                                                                        281 - 282
//

Text Mined References (18)

PMID Year Title
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20516191 2010 A rational nomenclature for serine/arginine-rich protein splicing factors (SR proteins).
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18281098 2008 Increased expression of splicing factor SRp20 mRNA in bipolar disorder patients.
17361132 2007 Unproductive splicing of SR genes associated with highly conserved and ultraconserved DNA elements.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11058868 2000 Identification of differentially expressed genes in human melanoma cells with acquired resistance to various antineoplastic drugs.
9671500 1998 Characterization of SRp46, a novel human SR splicing factor encoded by a PR264/SC35 retropseudogene.