Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 3.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 1.3e-03
atypical teratoid / rhabdoid tumor -1.300 3.2e-03
Breast cancer -1.300 9.5e-11
osteosarcoma -1.819 3.7e-04
ovarian cancer -1.200 2.2e-03
pancreatic ductal adenocarcinoma liver m... -1.118 2.7e-02

 GO Function (1)

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQD      1 - 70
AEAAMDGAELDGRELRVQVARYGRRDLPRSRQGEPRGRSRGGGYGRRSRSYGRRSRSPRRRHRSRSRGPS     71 - 140
CSRSRSRSRYRGSRYSRSPYSRSPYSRSRYSRSPYSRSRYRESRYGGSHYSSSGYSNSRYSRYHSSRSHS    141 - 210
KSGSSTSSRSASTSKSSSARRSKSSSVSRSRSRSRSSSMTRSPPRVSKRKSKSRSRSKRPPKSPEEEGQM    211 - 280
SS                                                                        281 - 282
//

Text Mined References (18)

PMID Year Title