Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 3.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 9.5013408915918E-11
osteosarcoma 7933 3.70232538869777E-4
adult high grade glioma 2148 0.00129114397046047
ovarian cancer 8492 0.00223315260509919
atypical teratoid / rhabdoid tumor 4369 0.0032114404822187
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0266264819256097

Synonym

Accession Q9BRL6 B2R6B8 Q6PF01 Q96TA3
Symbols DSM-1
SRP46
SFRS2B

Gene

PDB

2DNM  

  Ortholog (2)

Species Source
Macaque OMA Inparanoid
C. elegans OMA Inparanoid

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
25496916 Serine/arginine-rich splicing factor 8 (SRSF8) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS

AA Sequence

MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHDRRDAQD      1 - 70
AEAAMDGAELDGRELRVQVARYGRRDLPRSRQGEPRGRSRGGGYGRRSRSYGRRSRSPRRRHRSRSRGPS     71 - 140
CSRSRSRSRYRGSRYSRSPYSRSPYSRSRYSRSPYSRSRYRESRYGGSHYSSSGYSNSRYSRYHSSRSHS    141 - 210
KSGSSTSSRSASTSKSSSARRSKSSSVSRSRSRSRSSSMTRSPPRVSKRKSKSRSRSKRPPKSPEEEGQM    211 - 280
SS                                                                        281 - 282
//

Text Mined References (18)

PMID Year Title
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
20516191 2010 A rational nomenclature for serine/arginine-rich protein splicing factors (SR proteins).
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18281098 2008 Increased expression of splicing factor SRp20 mRNA in bipolar disorder patients.
17361132 2007 Unproductive splicing of SR genes associated with highly conserved and ultraconserved DNA elements.
More...