Property Summary

NCBI Gene PubMed Count 22
PubMed Score 535.24
PubTator Score 12.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.1e-06
psoriasis 6694 2.2e-05
lung adenocarcinoma 2716 8.9e-05
osteosarcoma 7950 1.9e-04
Multiple myeloma 1332 2.0e-03
astrocytoma 1146 2.1e-02
glioblastoma 5792 3.2e-02

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.200 2.1e-02
glioblastoma 1.500 3.2e-02
lung adenocarcinoma 1.150 8.9e-05
Multiple myeloma 1.523 2.0e-03
osteosarcoma 1.654 1.9e-04
ovarian cancer 2.000 1.1e-06
psoriasis 2.600 2.2e-05

Gene RIF (12)

AA Sequence

MVWPWVAMASRWGPLIGLAPCCLWLLGAVLLMDASARPANHSSTRERVANREENEILPPDHLNGVKLEMD      1 - 70
GHLNRGFHQEVFLGKDLGGFDEDAEPRRSRRKLMVIFSKVDVNTDRKISAKEMQRWIMEKTAEHFQEAME     71 - 140
ESKTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEETQEVLENLKDRWYQADSP    141 - 210
PADLLLTEEEFLSFLHPEHSRGMLRFMVKEIVRDLDQDGDKQLSVPEFISLPVGTVENQQGQDIDDNWVK    211 - 280
DRKKEFEELIDSNHDGIVTAEELESYMDPMNEYNALNEAKQMIAVADENQNHHLEPEEVLKYSEFFTGSK    281 - 350
LVDYARSVHEEF                                                              351 - 362
//

Text Mined References (27)

PMID Year Title