Property Summary

NCBI Gene PubMed Count 27
PubMed Score 8.01
PubTator Score 6.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 4.48801295897014E-4
glioblastoma 5572 0.00184983512390537
medulloblastoma, large-cell 6234 0.0187459912100243

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.100 0.002
medulloblastoma, large-cell 1.100 0.019

Synonym

Accession Q9BRK4 B1AL14 D3DR72 Q8N3I0 Q96J79 Q96JL2 hLZTS2
Symbols LAPSER1

Gene

  Ortholog (12)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Pathway (1)

Gene RIF (7)

PMID Text
23761130 LZTS2 could inhibit cell proliferation and cell cycle transition at the G1/S phase and was implicated in the regulation of proteins associated with the canonical Wnt pathway, including GSK3B and beta-catenin through inactivating the Akt pathway.
23275340 deletion of Lzts2 increases susceptibility to spontaneous and carcinogen-induced tumor development.
20508983 Observational study of gene-disease association. (HuGE Navigator)
18490357 LAPSER1 C terminal domain inhibits katanin(p80/p60)-mediated microtubule severing in vitro.
17950943 The reciprocal crosstalk between beta-catenin/Tcf pathway and NF-kappaB signaling in hMSCs is mediated through the regulation of lzts2 expression.
17000760 LZTS2 is a beta-catenin-interacting protein and modulates beta-catenin signaling and localization
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAIVQTLPVPLEPAPEAATAPQAPVMGSVSSLISGRPCPGGPAPPRHHGPPGPTFFRQQDGLLRGGYEAQ      1 - 70
EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHLRGPPPKLIPVSGKLEKNMEK     71 - 140
ILIRPTAFKPVLPKPRGAPSLPSFMGPRATGLSGSQGSLTQLFGGPASSSSSSSSSSAADKPLAFSGWAS    141 - 210
GCPSGTLSDSGRNSLSSLPTYSTGGAEPTTSSPGGHLPSHGSGRGALPGPARGVPTGPSHSDSGRSSSSK    211 - 280
STGSLGGRVAGGLLGSGTRASPDSSSCGERSPPPPPPPPSDEALLHCVLEGKLRDREAELQQLRDSLDEN    281 - 350
EATMCQAYEERQRHWQREREALREDCAAQAQRAQRAQQLLQLQVFQLQQEKRQLQDDFAQLLQEREQLER    351 - 420
RCATLEREQRELGPRLEETKWEVCQKSGEISLLKQQLKESQAELVQKGSELVALRVALREARATLRVSEG    421 - 490
RARGLQEAARARELELEACSQELQRHRQEAEQLREKAGQLDAEAAGLREPPVPPATADPFLLAESDEAKV    491 - 560
QRAAAGVGGSLRAQVERLRVELQRERRRGEEQRDSFEGERLAWQAEKEQVIRYQKQLQHNYIQMYRRNRQ    561 - 630
LEQELQQLSLELEARELADLGLAEQAPCICLEEITATEI                                   631 - 669
//

Text Mined References (33)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24464870 2014 mir-300 promotes self-renewal and inhibits the differentiation of glioma stem-like cells.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23761130 2013 Leucine zipper tumor suppressor 2 inhibits cell proliferation and regulates Lef/Tcf-dependent transcription through Akt/GSK3? signaling pathway in lung cancer.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23275340 2013 Deletion of leucine zipper tumor suppressor 2 (Lzts2) increases susceptibility to tumor development.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21949185 2011 The leucine zipper putative tumor suppressor 2 protein LZTS2 regulates kidney development.
More...