Property Summary

NCBI Gene PubMed Count 30
PubMed Score 8.29
PubTator Score 6.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 4.5e-04
glioblastoma 5792 1.8e-03
medulloblastoma, large-cell 6241 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 4.5e-04
glioblastoma 1.100 1.8e-03
medulloblastoma, large-cell 1.100 1.9e-02

Gene RIF (7)

AA Sequence

MAIVQTLPVPLEPAPEAATAPQAPVMGSVSSLISGRPCPGGPAPPRHHGPPGPTFFRQQDGLLRGGYEAQ      1 - 70
EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHLRGPPPKLIPVSGKLEKNMEK     71 - 140
ILIRPTAFKPVLPKPRGAPSLPSFMGPRATGLSGSQGSLTQLFGGPASSSSSSSSSSAADKPLAFSGWAS    141 - 210
GCPSGTLSDSGRNSLSSLPTYSTGGAEPTTSSPGGHLPSHGSGRGALPGPARGVPTGPSHSDSGRSSSSK    211 - 280
STGSLGGRVAGGLLGSGTRASPDSSSCGERSPPPPPPPPSDEALLHCVLEGKLRDREAELQQLRDSLDEN    281 - 350
EATMCQAYEERQRHWQREREALREDCAAQAQRAQRAQQLLQLQVFQLQQEKRQLQDDFAQLLQEREQLER    351 - 420
RCATLEREQRELGPRLEETKWEVCQKSGEISLLKQQLKESQAELVQKGSELVALRVALREARATLRVSEG    421 - 490
RARGLQEAARARELELEACSQELQRHRQEAEQLREKAGQLDAEAAGLREPPVPPATADPFLLAESDEAKV    491 - 560
QRAAAGVGGSLRAQVERLRVELQRERRRGEEQRDSFEGERLAWQAEKEQVIRYQKQLQHNYIQMYRRNRQ    561 - 630
LEQELQQLSLELEARELADLGLAEQAPCICLEEITATEI                                   631 - 669
//

Text Mined References (36)

PMID Year Title