Property Summary

NCBI Gene PubMed Count 27
Grant Count 5
R01 Count 5
Funding $416,866.75
PubMed Score 8.01
PubTator Score 6.91

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.100 0.002
medulloblastoma, large-cell 1.100 0.019

Gene RIF (7)

PMID Text
23761130 LZTS2 could inhibit cell proliferation and cell cycle transition at the G1/S phase and was implicated in the regulation of proteins associated with the canonical Wnt pathway, including GSK3B and beta-catenin through inactivating the Akt pathway.
23275340 deletion of Lzts2 increases susceptibility to spontaneous and carcinogen-induced tumor development.
20508983 Observational study of gene-disease association. (HuGE Navigator)
18490357 LAPSER1 C terminal domain inhibits katanin(p80/p60)-mediated microtubule severing in vitro.
17950943 The reciprocal crosstalk between beta-catenin/Tcf pathway and NF-kappaB signaling in hMSCs is mediated through the regulation of lzts2 expression.
17000760 LZTS2 is a beta-catenin-interacting protein and modulates beta-catenin signaling and localization
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAIVQTLPVPLEPAPEAATAPQAPVMGSVSSLISGRPCPGGPAPPRHHGPPGPTFFRQQDGLLRGGYEAQ      1 - 70
EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHLRGPPPKLIPVSGKLEKNMEK     71 - 140
ILIRPTAFKPVLPKPRGAPSLPSFMGPRATGLSGSQGSLTQLFGGPASSSSSSSSSSAADKPLAFSGWAS    141 - 210
GCPSGTLSDSGRNSLSSLPTYSTGGAEPTTSSPGGHLPSHGSGRGALPGPARGVPTGPSHSDSGRSSSSK    211 - 280
STGSLGGRVAGGLLGSGTRASPDSSSCGERSPPPPPPPPSDEALLHCVLEGKLRDREAELQQLRDSLDEN    281 - 350
EATMCQAYEERQRHWQREREALREDCAAQAQRAQRAQQLLQLQVFQLQQEKRQLQDDFAQLLQEREQLER    351 - 420
RCATLEREQRELGPRLEETKWEVCQKSGEISLLKQQLKESQAELVQKGSELVALRVALREARATLRVSEG    421 - 490
RARGLQEAARARELELEACSQELQRHRQEAEQLREKAGQLDAEAAGLREPPVPPATADPFLLAESDEAKV    491 - 560
QRAAAGVGGSLRAQVERLRVELQRERRRGEEQRDSFEGERLAWQAEKEQVIRYQKQLQHNYIQMYRRNRQ    561 - 630
LEQELQQLSLELEARELADLGLAEQAPCICLEEITATEI                                   631 - 669
//

Text Mined References (33)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24464870 2014 mir-300 promotes self-renewal and inhibits the differentiation of glioma stem-like cells.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23761130 2013 Leucine zipper tumor suppressor 2 inhibits cell proliferation and regulates Lef/Tcf-dependent transcription through Akt/GSK3? signaling pathway in lung cancer.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23275340 2013 Deletion of leucine zipper tumor suppressor 2 (Lzts2) increases susceptibility to tumor development.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21949185 2011 The leucine zipper putative tumor suppressor 2 protein LZTS2 regulates kidney development.
More...