Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.17
PubTator Score 1.07

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BRK3 B3KTR6 B4DE34 Q5TA39 Q96KC3
Symbols

Gene

Gene RIF (3)

PMID Text
23386276 exogenous expression of DICAM in human umbilical vein endothelial cells suppressed angiogenesis in vitro Matrigel and in vivo plug assays, and conversely, DICAM knockdown enhanced angiogenesis
21555518 MXRA8 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
14603461 new member of the transmembrane-type immunoglobulin superfamily and designated limitrin, localizing selectively to glia limitans in mouse brain

AA Sequence

MALPSRILLWKLVLLQSSAVLLHSGSSVPAAAGSSVVSESAVSWEAGARAVLRCQSPRMVWTQDRLHDRQ      1 - 70
RVLHWDLRGPGGGPARRLLDLYSAGEQRVYEARDRGRLELSASAFDDGNFSLLIRAVEETDAGLYTCNLH     71 - 140
HHYCHLYESLAVRLEVTDGPPATPAYWDGEKEVLAVARGAPALLTCVNRGHVWTDRHVEEAQQVVHWDRQ    141 - 210
PPGVPHDRADRLLDLYASGERRAYGPLFLRDRVAVGADAFERGDFSLRIEPLEVADEGTYSCHLHHHYCG    211 - 280
LHERRVFHLTVAEPHAEPPPRGSPGNGSSHSGAPGPDPTLARGHNVINVIVPESRAHFFQQLGYVLATLL    281 - 350
LFILLLVTVLLAARRRRGGYEYSDQKSGKSKGKDVNLAEFAVAAGDQMLYRSEDIQLDYKNNILKERAEL    351 - 420
AHSPLPAKYIDLDKGFRKENCK                                                    421 - 442
//

Text Mined References (13)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23386276 2013 DICAM inhibits angiogenesis via suppression of AKT and p38 MAP kinase signalling.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14603461 2003 Limitrin, a novel immunoglobulin superfamily protein localized to glia limitans formed by astrocyte endfeet.
More...