Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.25
PubTator Score 1.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (3)

AA Sequence

MALPSRILLWKLVLLQSSAVLLHSGSSVPAAAGSSVVSESAVSWEAGARAVLRCQSPRMVWTQDRLHDRQ      1 - 70
RVLHWDLRGPGGGPARRLLDLYSAGEQRVYEARDRGRLELSASAFDDGNFSLLIRAVEETDAGLYTCNLH     71 - 140
HHYCHLYESLAVRLEVTDGPPATPAYWDGEKEVLAVARGAPALLTCVNRGHVWTDRHVEEAQQVVHWDRQ    141 - 210
PPGVPHDRADRLLDLYASGERRAYGPLFLRDRVAVGADAFERGDFSLRIEPLEVADEGTYSCHLHHHYCG    211 - 280
LHERRVFHLTVAEPHAEPPPRGSPGNGSSHSGAPGPDPTLARGHNVINVIVPESRAHFFQQLGYVLATLL    281 - 350
LFILLLVTVLLAARRRRGGYEYSDQKSGKSKGKDVNLAEFAVAAGDQMLYRSEDIQLDYKNNILKERAEL    351 - 420
AHSPLPAKYIDLDKGFRKENCK                                                    421 - 442
//

Text Mined References (13)

PMID Year Title