Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.37
PubTator Score 3.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
breast carcinoma -1.300 3.7e-04
lung adenocarcinoma 1.200 2.6e-06
lung carcinoma 1.500 3.1e-35
malignant mesothelioma -1.700 8.8e-07
osteosarcoma 1.118 1.2e-04

 GO Function (1)

Gene RIF (3)

AA Sequence

MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKI      1 - 70
AFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKG     71 - 140
VLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASED    141 - 210
DMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA                                211 - 252
//

Text Mined References (17)

PMID Year Title