Property Summary

NCBI Gene PubMed Count 16
Grant Count 7
R01 Count 7
Funding $922,186.5
PubMed Score 2.82
PubTator Score 3.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
osteosarcoma 1.118 0.000
breast carcinoma -1.300 0.000
lung adenocarcinoma 1.200 0.000
lung carcinoma 1.500 0.000

Synonym

Accession Q9BRK0 Q53EM8 Q9NYF2
Symbols SPG72
Yip2d
C5orf19
SGC32445

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
24388663 We have identified mutations in REEP2 in two families with relatively pure, early-onset hereditary spastic paraplegia, one with autosomal-dominant and the other with autosomal-recessive transmission.
24355597 Expression of the REEP1/REEP2 subfamily appears to be restricted to neuronal and neuronal-like exocytotic tissues, consistent with neuronally restricted symptoms of REEP1 genetic disorders.
20943918 In mouse, Reep2 enhances sweet receptor function by a different mechanism than Reep1 uses to enhance olfactory receptor function.

AA Sequence

MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKI      1 - 70
AFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKG     71 - 140
VLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASED    141 - 210
DMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA                                211 - 252
//

Text Mined References (17)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24388663 2014 Loss of association of REEP2 with membranes leads to hereditary spastic paraplegia.
24355597 2014 REEP1 and REEP2 proteins are preferentially expressed in neuronal and neuronal-like exocytotic tissues.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20943918 2010 REEP2 enhances sweet receptor function by recruitment to lipid rafts.
16720576 2006 Members of RTP and REEP gene families influence functional bitter taste receptor expression.
16271481 2005 Inherited ACTH insensitivity illuminates the mechanisms of ACTH action.
15550249 2004 RTP family members induce functional expression of mammalian odorant receptors.
More...