Property Summary

NCBI Gene PubMed Count 14
PubMed Score 33.52
PubTator Score 7.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Ethylmalonic encephalopathy 12 4.475 2.2

Expression

Gene RIF (2)

AA Sequence

MSTAAVPELKQISRVEAMRLGPGWSHSCHAMLYAANPGQLFGRIPMRFSVLMQMRFDGLLGFPGGFVDRR      1 - 70
FWSLEDGLNRVLGLGLGCLRLTEADYLSSHLTEGPHRVVAHLYARQLTLEQLHAVEISAVHSRDHGLEVL     71 - 140
GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVEALAAATEKQKKALEKLLPAS    141 - 210
S//

Text Mined References (15)

PMID Year Title