Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.23
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 4104 3.0e-03
osteosarcoma 7950 3.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

 GO Function (1)

Gene RIF (1)

AA Sequence

MAAPIPQGFSCLSRFLGWWFRQPVLVTQSAAIVPVRTKKRFTPPIYQPKFKTEKEFMQHARKAGLVIPPE      1 - 70
KSDRSIHLACTAGIFDAYVPPEGDARISSLSKEGLIERTERMKKTMASQVSIRRIKDYDANFKIKDFPEK     71 - 140
AKDIFIEAHLCLNNSDHDRLHTLVTEHCFPDMTWDIKYKTVRWSFVESLEPSHVVQVRCSSMMNQGNVYG    141 - 210
QITVRMHTRQTLAIYDRFGRLMYGQEDVPKDVLEYVVFEKQLTNPYGSWRMHTKIVPPWAPPKQPILKTV    211 - 280
MIPGPQLKPEEEYEEAQGEAQKPQLA                                                281 - 306
//

Text Mined References (18)

PMID Year Title