Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.33
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 4104 8.8e-05
Disease Target Count Z-score Confidence
Pulmonary sclerosing hemangioma 8 5.09 2.5

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 2.000 8.8e-05

Gene RIF (1)

AA Sequence

MAATFQLPGHQEMPLTFQDVAVYFSQAEGRQLGPQQRALYRDVMLENYGNVASLGFPVPKPELISQLEQG      1 - 70
KELWVLNLLGAEEPDILKSCQKDSEVGTKKELSILNQKFSEEVKTPEFVSRRLLRDNAQAAEFREAWGRE     71 - 140
GKLKERVGNSAGQSLNKPNIHKRVLTEATVGRERSLGERTQECSAFDRNLNLDQNVVRLQRNKTGERVFK    141 - 210
CDICSKTFKYNSDLSRHQRSHTGEKPYECGRCGRAFTHSSNLVLHHHIHTGNKPFKCDECGKTFGLNSHL    211 - 280
RLHRRIHTGEKPFGCGECGKAFSRSSTLIQHRIIHTGEKPYKCNECGRGFSQSPQLTQHQRIHTGEKPHE    281 - 350
CSHCGKAFSRSSSLIQHERIHTGEKPHKCNQCGKAFSQSSSLFLHHRVHTGEKPYVCNECGRAFGFNSHL    351 - 420
TEHVRIHTGEKPYVCNECGKAFRRSSTLVQHRRVHTGEKPYQCVECGKAFSQSSQLTLHQRVHTGEKPYD    421 - 490
CGDCGKAFSRRSTLIQHQKVHSGETRKCRKHGPAFVHGSSLTADGQIPTGEKHGRAFNHGANLILRWTVH    491 - 560
TGEKSFGCNEYGKAFSPTSRPTEDQIMHAGEKPYKCQECGNAFSGKSTLIQHQVTHTGQKPCHCSVYGKA    561 - 630
FSQSSQLTPPQQTRVGEKPALNDGSKRYFIHIKKIFQERHF                                 631 - 671
//

Text Mined References (9)

PMID Year Title