Property Summary

NCBI Gene PubMed Count 26
Grant Count 7
Funding $413,464.06
PubMed Score 16.11
PubTator Score 8.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.142 0.006
diabetes mellitus -1.200 0.002

Gene RIF (13)

PMID Text
26268989 HIV-1 release (as measured by CA-p24 levels) from cells involves VPS25 (EAP20)
26268989 HIV-1 release (as measured by CA-p24 levels) from cells involves VPS25 (EAP20)
26268989 HIV-1 release (as measured by CA-p24 levels) from cells involves VPS25 (EAP20)
26268989 HIV-1 release (as measured by CA-p24 levels) from cells involves VPS25 (EAP20)
26268989 HIV-1 release (as measured by CA-p24 levels) from cells involves VPS25 (EAP20)
26268989 HIV-1 release (as measured by CA-p24 levels) from cells involves VPS25 (EAP20)
26268989 shRNA knockdown of VPS25 (ESCRT-II component) impairs HIV-1 CA-p24 production when using wild type (HIV-1 LAI) and VSV-pseudotyped virus; HIV replication is enhanced by VPS25
23305486 HIV-1 release (as measured by CA-p24 levels) from cells involves VPS25 (EAP20)
21543492 HIV-1 release (as measured by CA-p24 levels) from cells involves VPS25 (EAP20)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLP      1 - 70
VESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEE     71 - 140
FHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF                                      141 - 176
//

Text Mined References (31)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19686684 2009 Structure and function of the ESCRT-II-III interface in multivesicular body biogenesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...