Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.97
PubTator Score 3.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 2.700 0.000
astrocytic glioma -1.500 0.032
ependymoma -1.200 0.045
oligodendroglioma -1.100 0.034
psoriasis -1.500 0.001
osteosarcoma -1.941 0.002
cystic fibrosis 1.704 0.000
primary pancreatic ductal adenocarcinoma 1.030 0.004
tuberculosis 3.000 0.000
non-small cell lung cancer -1.268 0.000
pilocytic astrocytoma 1.500 0.000
aldosterone-producing adenoma -1.114 0.007
spina bifida -1.134 0.038
ovarian cancer -1.100 0.000
pituitary cancer -1.100 0.000

Synonym

Accession Q9BRF8 B4DQ68 Q6MZY9 Q9H9M9 Q9NUT6
Symbols CSTP1

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
23939394 CPPED1 is involved in glucose uptake in adipocytes
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSAAEAGGVFHRARGRTLAAFPAEKESEWKGPFYFILGADPQFGLIKAWSTGDCDNGGDEWEQEIRLTEQ      1 - 70
AVQAINKLNPKPKFFVLCGDLIHAMPGKPWRTEQTEDLKRVLRAVDRAIPLVLVSGNHDIGNTPTAETVE     71 - 140
EFCRTWGDDYFSFWVGGVLFLVLNSQFYENPSKCPSLKQAQDQWLDEQLSIARQRHCQHAIVFQHIPLFL    141 - 210
ESIDEDDDYYFNLSKSTRKKLADKFIHAGVKVVFSGHYHRNAGGTYQNLDMVVSSAIGCQLGRDPHGLRV    211 - 280
VVVTAEKIVHRYYSLDELSEKGIEDDLMDLIKKK                                        281 - 314
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23939394 2013 Downregulation of CPPED1 expression improves glucose metabolism in vitro in adipocytes.
23799035 2013 CSTP1, a novel protein phosphatase, blocks cell cycle, promotes cell apoptosis, and suppresses tumor growth of bladder cancer by directly dephosphorylating Akt at Ser473 site.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...