Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.70
PubTator Score 3.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
aldosterone-producing adenoma -1.114 6.8e-03
astrocytic glioma -1.500 3.2e-02
Astrocytoma, Pilocytic 1.400 3.0e-04
cystic fibrosis 1.424 2.0e-04
ependymoma -1.200 4.5e-02
malignant mesothelioma 2.700 4.0e-08
non-small cell lung cancer -1.268 5.4e-23
oligodendroglioma -1.100 3.4e-02
osteosarcoma -1.439 1.9e-02
ovarian cancer -1.100 4.6e-04
pituitary cancer -1.100 1.4e-05
primary pancreatic ductal adenocarcinoma 1.030 4.3e-03
psoriasis -1.500 1.2e-03
spina bifida -1.026 4.4e-02
tuberculosis 3.000 7.3e-08

 GO Process (1)

Gene RIF (2)

AA Sequence

MSAAEAGGVFHRARGRTLAAFPAEKESEWKGPFYFILGADPQFGLIKAWSTGDCDNGGDEWEQEIRLTEQ      1 - 70
AVQAINKLNPKPKFFVLCGDLIHAMPGKPWRTEQTEDLKRVLRAVDRAIPLVLVSGNHDIGNTPTAETVE     71 - 140
EFCRTWGDDYFSFWVGGVLFLVLNSQFYENPSKCPSLKQAQDQWLDEQLSIARQRHCQHAIVFQHIPLFL    141 - 210
ESIDEDDDYYFNLSKSTRKKLADKFIHAGVKVVFSGHYHRNAGGTYQNLDMVVSSAIGCQLGRDPHGLRV    211 - 280
VVVTAEKIVHRYYSLDELSEKGIEDDLMDLIKKK                                        281 - 314
//

Text Mined References (17)

PMID Year Title