Property Summary

NCBI Gene PubMed Count 14
PubMed Score 45.15
PubTator Score 35.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma 1.300 9.5e-05
glioblastoma multiforme 1.200 9.6e-21
invasive ductal carcinoma 1.110 2.7e-03
lung adenocarcinoma 1.500 1.3e-08
non-small cell lung cancer 1.139 4.4e-18
ovarian cancer 1.700 1.8e-04
psoriasis 1.300 9.1e-47

Synonym

Accession Q9BRA2 A8K7E8
Symbols TRP14
TXNL5

Gene

PANTHER Protein Class (1)

PDB

1WOU  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQ      1 - 70
VGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED                      71 - 123
//

Text Mined References (17)

PMID Year Title