Property Summary

NCBI Gene PubMed Count 14
Grant Count 6
Funding $1,633,786
PubMed Score 42.68
PubTator Score 35.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma multiforme 1.200 0.000
non-small cell lung cancer 1.139 0.000
breast carcinoma 1.300 0.000
psoriasis 1.400 0.000
lung adenocarcinoma 1.500 0.000
invasive ductal carcinoma 1.110 0.003
ovarian cancer 1.700 0.000

Gene RIF (7)

PMID Text
26976343 found STAT3 could bind promoter region of TXNDC17 (-623 bp to -58 bp relative to the transcription start site (TSS)) for regulating its expression
25607466 TXNDC17, through participation of BECN1, induces autophagy and consequently results in paclitaxel resistance in ovarian cancer
24778250 The oxidoreductase activities of TRP14 thereby complement those of Trx1 and must therefore be considered for the full understanding of enzymatic control of cellular thiols and nitrosothiols.
18579519 LC8 binds IkappaBalpha in a redox-dependent manner and thereby prevents its phosphorylation by IKK. TRP14 contributes to this inhibitory activity by maintaining LC8 in a reduced state.
15355959 Data report the crystal structure of human thioredoxin-related protein 14 determined at 1.8-angstrom resolution.
14607844 TRP14 is a thioredoxin-related protein of 14 kDa
14607843 TRP14 is a thioredoxin-related protein with roles in tumor necrosis factor-alpha signaling pathways

AA Sequence

MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQ      1 - 70
VGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED                      71 - 123
//

Text Mined References (17)

PMID Year Title
26976343 2016 STAT3-dependent TXNDC17 expression mediates Taxol resistance through inducing autophagy in human colorectal cancer cells.
25607466 2015 TXNDC17 promotes paclitaxel resistance via inducing autophagy in ovarian cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24778250 2014 Thioredoxin-related protein of 14 kDa is an efficient L-cystine reductase and S-denitrosylase.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...