Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.02
PubTator Score 0.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 3.25104211583528E-8
ovarian cancer 8492 1.64327682606679E-5
medulloblastoma, large-cell 6234 0.00191433318935621
non primary Sjogren syndrome sicca 840 0.0296793122642295

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.002
tuberculosis 1.100 0.000
non primary Sjogren syndrome sicca 1.300 0.030
ovarian cancer 2.100 0.000

Synonym

Accession Q9BRA0 Q8N4M0
Symbols LSMD1
PFAAP2

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Xenopus OMA EggNOG

AA Sequence

MAGAGPTMLLREENGCCSRRQSSSSAGDSDGEREDSAAERARQQLEALLNKTMRIRMTDGRTLVGCFLCT      1 - 70
DRDCNVILGSAQEFLKPSDSFSAGEPRVLGLAMVPGHHIVSIEVQRESLTGPPYL                    71 - 125
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19660095 2009 A synopsis of eukaryotic Nalpha-terminal acetyltransferases: nomenclature, subunits and substrates.
19398576 2009 Knockdown of human N alpha-terminal acetyltransferase complex C leads to p53-dependent apoptosis and aberrant human Arl8b localization.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16484612 2006 Embryonic growth-associated protein is one subunit of a novel N-terminal acetyltransferase complex essential for embryonic vascular development.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.