Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.02
PubTator Score 0.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell -1.100 1.9e-03
non primary Sjogren syndrome sicca 1.300 3.0e-02
ovarian cancer 2.100 1.6e-05
tuberculosis 1.100 3.3e-08

AA Sequence

MAGAGPTMLLREENGCCSRRQSSSSAGDSDGEREDSAAERARQQLEALLNKTMRIRMTDGRTLVGCFLCT      1 - 70
DRDCNVILGSAQEFLKPSDSFSAGEPRVLGLAMVPGHHIVSIEVQRESLTGPPYL                    71 - 125
//

Text Mined References (10)

PMID Year Title