Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 3.9e-05
Breast cancer -1.400 2.7e-08
ependymoma 2.100 1.9e-02
gastric cancer 1.100 8.8e-03
glioblastoma 1.300 2.6e-09
group 3 medulloblastoma 2.200 3.3e-06
invasive ductal carcinoma -1.100 3.4e-02
oligodendroglioma 1.800 9.6e-03
ovarian cancer -2.000 1.5e-06
pediatric high grade glioma 1.200 5.4e-06
primitive neuroectodermal tumor 1.300 2.4e-03
psoriasis -1.100 2.7e-26

AA Sequence

MVAGWLTNYSQDSVTFEDVAVDFTQEEWTLLDQTQRNLYRDVMLENYKNLVAVDWESHINTKWSAPQQNF      1 - 70
LQGKTSSVVEMERNHFGEELFDFNQCEKALSEHSCLKTHRRTYFRKKTCECNQCEKAFRKPSIFTLHKKT     71 - 140
DIGEELPNCNQCETAFSQHLHLVCKKTSQNLHLVCKKTHTQEKPYKCSDCEKGLPSSSHLRECVRIYGGE    141 - 210
RPYTHKEYVETFSHSTALFVHMQTQDGEKFYECKACGKPFTESSYLTQHLRTHSRVLPIEHKKFGKAFAF    211 - 280
SPDLAKHIRLRTRGKHYVCNECGKEFTCFSKLNIHIRVHTGEKPYECNKCGKAFTDSSGLIKHRRTHTGE    281 - 350
KPYECKECGKAFANSSHLTVHMRTHTGEKPYQCKECGKAFINSSSFKSHMQTHPGVKPYDCQQCGKAFIR    351 - 420
SSFLIRHLRSHSAERPFECEECGKAFRYSSHLSQHKRIHTGERPYKCQKCGQAFSISSGLTVHMRTHTGE    421 - 490
RPFECQECGKAFTRSTYLIRHLRSHSVEKPYKECGQTFSNSSCLTECV                          491 - 538
//

Text Mined References (9)

PMID Year Title