Property Summary

NCBI Gene PubMed Count 20
Grant Count 14
R01 Count 9
Funding $820,743
PubMed Score 12.63
PubTator Score 11.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
coronin-1A deficiency 3 4.445 2.2

Expression

Gene RIF (6)

PMID Text
27046832 When cells undergo apoptosis in an epithelial monolayer, coronin 1B is recruited to the junctional cortex at apoptotic/neighbor cell interface in an E-cadherin-dependent fashion to support actin architectural reorganization, contractility, and extrusion.
23667561 Coronin 1B regulates S1P-induced human lung endothelial cell chemotaxis.
22563075 analysis of the mechanism for negatively regulating Rho-kinase (ROCK) signaling through Coronin1B protein in neuregulin 1 (NRG-1)-induced tumor cell motility
17350576 Study concludes that Coronin 1B's coordination of filament formation by Arp2/3 complex and filament turnover by Cofilin is required for effective lamellipodial protrusion and cell migration.
16027158 Coronin 1B regulates leading edge dynamics and controls cell motility and interactions with the actin-related protein (Arp)2/3 complex
9915840 In rabbits, cholinergic stimulation increases the phosphorylation of coronin 1B in gastric mucosal cells

AA Sequence

MSFRKVVRQSKFRHVFGQPVKNDQCYEDIRVSRVTWDSTFCAVNPKFLAVIVEASGGGAFLVLPLSKTGR      1 - 70
IDKAYPTVCGHTGPVLDIDWCPHNDEVIASGSEDCTVMVWQIPENGLTSPLTEPVVVLEGHTKRVGIIAW     71 - 140
HPTARNVLLSAGCDNVVLIWNVGTAEELYRLDSLHPDLIYNVSWNHNGSLFCSACKDKSVRIIDPRRGTL    141 - 210
VAEREKAHEGARPMRAIFLADGKVFTTGFSRMSERQLALWDPENLEEPMALQELDSSNGALLPFYDPDTS    211 - 280
VVYVCGKGDSSIRYFEITEEPPYIHFLNTFTSKEPQRGMGSMPKRGLEVSKCEIARFYKLHERKCEPIVM    281 - 350
TVPRKSDLFQDDLYPDTAGPEAALEAEEWVSGRDADPILISLREAYVPSKQRDLKISRRNVLSDSRPAMA    351 - 420
PGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA     421 - 489
//

Text Mined References (25)

PMID Year Title
27046832 2016 Coronin 1B Reorganizes the Architecture of F-Actin Networks for Contractility at Steady-State and Apoptotic Adherens Junctions.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23667561 2013 Coronin 1B regulates S1P-induced human lung endothelial cell chemotaxis: role of PLD2, protein kinase C and Rac1 signal transduction.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22619279 2012 Role of coronin 1B in PDGF-induced migration of vascular smooth muscle cells.
22563075 2012 Novel mechanism for negatively regulating Rho-kinase (ROCK) signaling through Coronin1B protein in neuregulin 1 (NRG-1)-induced tumor cell motility.
22364218 2012 Coronin 1C harbours a second actin-binding site that confers co-operative binding to F-actin.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
More...