Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.77
PubTator Score 2.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 4.1e-06
osteosarcoma 7950 1.3e-03
group 3 medulloblastoma 4104 3.8e-03

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.8e-03
osteosarcoma -1.239 1.3e-03
ovarian cancer 1.700 4.1e-06

Gene RIF (4)

AA Sequence

MASSFLPAGAITGDSGGELSSGDDSGEVEFPHSPEIEETSCLAELFEKAAAHLQGLIQVASREQLLYLYA      1 - 70
RYKQVKVGNCNTPKPSFFDFEGKQKWEAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEANTG     71 - 140
FGGPVISSLYHEETIREEDKNIFDYCRENNIDHITKAIKSKNVDVNVKDEEGRALLHWACDRGHKELVTV    141 - 210
LLQHRADINCQDNEGQTALHYASACEFLDIVELLLQSGADPTLRDQDGCLPEEVTGCKTVSLVLQRHTTG    211 - 280
KA                                                                        281 - 282
//

Text Mined References (13)

PMID Year Title