Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.77
PubTator Score 2.03

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.239 0.001
group 3 medulloblastoma 1.100 0.004
ovarian cancer 1.700 0.000

Gene RIF (4)

PMID Text
26621918 ligand binding properties of the NMT/ACBD6 complex can explain how the NMT reaction can proceed in the presence of the very abundant competitive substrate, C(16)-CoA.
26290611 Findings provide evidence that the binding properties of ACBD6 are adapted to prevent its constant saturation by the very abundant C16:0-CoA and protect membrane systems.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18268358 ACBD6 is a modular protein that carries an acyl-CoA binding domain at its N terminus and two ankyrin motifs at its C terminus.

AA Sequence

MASSFLPAGAITGDSGGELSSGDDSGEVEFPHSPEIEETSCLAELFEKAAAHLQGLIQVASREQLLYLYA      1 - 70
RYKQVKVGNCNTPKPSFFDFEGKQKWEAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEANTG     71 - 140
FGGPVISSLYHEETIREEDKNIFDYCRENNIDHITKAIKSKNVDVNVKDEEGRALLHWACDRGHKELVTV    141 - 210
LLQHRADINCQDNEGQTALHYASACEFLDIVELLLQSGADPTLRDQDGCLPEEVTGCKTVSLVLQRHTTG    211 - 280
KA                                                                        281 - 282
//

Text Mined References (13)

PMID Year Title
26621918 2016 Association of NMT2 with the acyl-CoA carrier ACBD6 protects the N-myristoyltransferase reaction from palmitoyl-CoA.
26290611 2015 Ligand binding to the ACBD6 protein regulates the acyl-CoA transferase reactions in membranes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18268358 2008 Characterization of an acyl-coenzyme A binding protein predominantly expressed in human primitive progenitor cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...