Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BR46
Symbols dJ1068E13.1

Gene

 Compartment GO Term (1)

AA Sequence

MFQVFKPHAGEDYKYPRETETIWSHPYVVEGSHKSPLESLSLHGCLAAMAPSITSSEDSSPSQRDKKDLS      1 - 70
LDLLLTRKKRSQGLHWSHWQGLNHMSIRIHTPEQGSPSLGQNWSWGNRKEKGVAQRQVPTTGTHSFFHCT     71 - 140
SEGNKEKPHHF                                                               141 - 151
//

Text Mined References (1)

PMID Year Title
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.