Property Summary

NCBI Gene PubMed Count 21
PubMed Score 163.00
PubTator Score 20.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
CARDIOMYOPATHY, FAMILIAL HYPERTROPHIC, 17 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Hypertrophic Cardiomyopathy 117 4.108 2.1
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0
Disease Target Count Z-score Confidence
periodontitis 293 5.61 2.8
leukocyte-adhesion deficiency syndrome 8 3.062 1.5
Disease Target Count
hypertrophic cardiomyopathy 17 1

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.200 9.0e-04
Breast cancer 1.100 2.7e-02
cystic fibrosis -1.175 1.5e-04
malignant mesothelioma 1.500 3.4e-06
medulloblastoma, large-cell 1.200 2.2e-04
osteosarcoma 1.217 2.8e-02
ovarian cancer 1.300 8.5e-12
psoriasis -1.700 9.0e-67

Gene RIF (14)

AA Sequence

MSGGRFDFDDGGAYCGGWEGGKAHGHGLCTGPKGQGEYSGSWNFGFEVAGVYTWPSGNTFEGYWSQGKRH      1 - 70
GLGIETKGRWLYKGEWTHGFKGRYGIRQSSSSGAKYEGTWNNGLQDGYGTETYADGGTYQGQFTNGMRHG     71 - 140
YGVRQSVPYGMAVVVRSPLRTSLSSLRSEHSNGTVAPDSPASPASDGPALPSPAIPRGGFALSLLANAEA    141 - 210
AARAPKGGGLFQRGALLGKLRRAESRTSVGSQRSRVSFLKSDLSSGASDAASTASLGEAAEGADEAAPFE    211 - 280
ADIDATTTETYMGEWKNDKRSGFGVSERSSGLRYEGEWLDNLRHGYGCTTLPDGHREEGKYRHNVLVKDT    281 - 350
KRRMLQLKSNKVRQKVEHSVEGAQRAAAIARQKAEIAASRTSHAKAKAEAAEQAALAANQESNIARTLAR    351 - 420
ELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGAGAAGLPQPPRESPQLHERETPRPEGGSPSPAGT    421 - 490
PPQPKRPRPGVSKDGLLSPGAWNGEPSGEGSRSVTPSEGAGRRSPARPATERMAIEALQAPPAPSREPEV    491 - 560
ALYQGYHSYAVRTTPPEPPPFEDQPEPEVSGSESAPSSPATAPLQAPTLRGPEPARETPAKLEPKPIIPK    561 - 630
AEPRAKARKTEARGLTKAGAKKKARKEAALAAEAEVEVEEVPNTILICMVILLNIGLAILFVHLLT        631 - 696
//

Text Mined References (23)

PMID Year Title