Property Summary

NCBI Gene PubMed Count 2
PubMed Score 6.79
PubTator Score 2.54

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BR26 OC-STAMP
Symbols OC-STAMP
C20orf123
dJ257E24.3

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

AA Sequence

MPGHPGAAEQLVKTGWRSWHLGFWKALAPLQAAWDAFSQPVPASCGQLLTQLLLCASLAAAAAGLVYHWL      1 - 70
ASLLLYPPGPSAMVATVCGLLVFLSLGLVPPVRCLFALSVPTLGMEQGRRLLLSYSTATLAIAVVPNVLA     71 - 140
NVGAAGQVLRCVTEGSLESLLNTTHQLHAASRALGPTGQAGSRGLTFEAQDNGSAFYLHMLRVTQQVLED    141 - 210
FSGLESLARAAALGTQRVVTGLFMLGLLVESAWYLHCYLTDLRFDNIYATQQLTQRLAQAQATHLLAPPP    211 - 280
TWLLQAAQLRLSQEELLSCLLRLGLLALLLVATAVAVATDHVAFLLAQATVDWAQKLPTVPITLTVKYDV    281 - 350
AYTVLGFIPFLFNQLAPESPFLSVHSSYQWELRLTSARCPLLPARRPRAAAPLAAGALQLLAGSTVLLEA    351 - 420
YARRLRHAIAASFFTAQEARRVRHLHARLQRRHDRHQGQQLPLGDPSCVPTPRPACKPPAWIDYRLDALR    421 - 490
TESSEGEGKELWSCRDLSCNLGPVPPPCVTLGKSLHLSEPRFLHLHNDSIFTIDVTYFPRRDVVRMEGNT    491 - 560
GHDRPG                                                                    561 - 566
//

Text Mined References (3)

PMID Year Title
18064667 2008 Osteoclast stimulatory transmembrane protein (OC-STAMP), a novel protein induced by RANKL that promotes osteoclast differentiation.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11181995 2001 The sequence of the human genome.