Property Summary

NCBI Gene PubMed Count 2
Grant Count 2
R01 Count 2
Funding $142,038.6
PubMed Score 6.79
PubTator Score 2.54

Knowledge Summary

Patent

No data available

AA Sequence

MPGHPGAAEQLVKTGWRSWHLGFWKALAPLQAAWDAFSQPVPASCGQLLTQLLLCASLAAAAAGLVYHWL      1 - 70
ASLLLYPPGPSAMVATVCGLLVFLSLGLVPPVRCLFALSVPTLGMEQGRRLLLSYSTATLAIAVVPNVLA     71 - 140
NVGAAGQVLRCVTEGSLESLLNTTHQLHAASRALGPTGQAGSRGLTFEAQDNGSAFYLHMLRVTQQVLED    141 - 210
FSGLESLARAAALGTQRVVTGLFMLGLLVESAWYLHCYLTDLRFDNIYATQQLTQRLAQAQATHLLAPPP    211 - 280
TWLLQAAQLRLSQEELLSCLLRLGLLALLLVATAVAVATDHVAFLLAQATVDWAQKLPTVPITLTVKYDV    281 - 350
AYTVLGFIPFLFNQLAPESPFLSVHSSYQWELRLTSARCPLLPARRPRAAAPLAAGALQLLAGSTVLLEA    351 - 420
YARRLRHAIAASFFTAQEARRVRHLHARLQRRHDRHQGQQLPLGDPSCVPTPRPACKPPAWIDYRLDALR    421 - 490
TESSEGEGKELWSCRDLSCNLGPVPPPCVTLGKSLHLSEPRFLHLHNDSIFTIDVTYFPRRDVVRMEGNT    491 - 560
GHDRPG                                                                    561 - 566
//

Text Mined References (3)

PMID Year Title
18064667 2008 Osteoclast stimulatory transmembrane protein (OC-STAMP), a novel protein induced by RANKL that promotes osteoclast differentiation.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11181995 2001 The sequence of the human genome.