Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Azoospermia 110 3.717 1.9

Expression

Synonym

Accession Q9BR10
Symbols TSG23
C20orf165
dJ337O18.8

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MSYFRTPQTHPGPLPSGQGGAASPGLSLGLCSPVEPVVVASGGTGPLSQKAEQVAPAAQAWGPALAMPQA      1 - 70
RGCPGGTSWETLRKEYSRNCHKFPHVRQLESLGWDNGYSRSRAPDLGGPSRPRPLMLCGLSPRVLPVPSE     71 - 140
AVGKEASSQPDICILTLAMMIAGIPTVPVPGVREEDLIWAAQAFMMAHPEPEGAVEGARWEQAHAHTASG    141 - 210
KMPLVRSKRGQPPGSCL                                                         211 - 227
//

Text Mined References (4)

PMID Year Title