Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Azoospermia 89 3.711 1.9

Expression

Gene RIF (1)

PMID Text
19240080 study identified a novel gene, TSG23/Tsg23, which is developmentally & highly expressed in testis; data suggest that TSG23/Tsg23 is involved in human and mouse spermatogenesis

AA Sequence

MSYFRTPQTHPGPLPSGQGGAASPGLSLGLCSPVEPVVVASGGTGPLSQKAEQVAPAAQAWGPALAMPQA      1 - 70
RGCPGGTSWETLRKEYSRNCHKFPHVRQLESLGWDNGYSRSRAPDLGGPSRPRPLMLCGLSPRVLPVPSE     71 - 140
AVGKEASSQPDICILTLAMMIAGIPTVPVPGVREEDLIWAAQAFMMAHPEPEGAVEGARWEQAHAHTASG    141 - 210
KMPLVRSKRGQPPGSCL                                                         211 - 227
//

Text Mined References (4)

PMID Year Title
19240080 2009 Developmental expression pattern of a novel gene, TSG23/Tsg23, suggests a role in spermatogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.