Property Summary

NCBI Gene PubMed Count 26
PubMed Score 71.25
PubTator Score 30.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -3.600 1.4e-06
astrocytic glioma -2.900 2.4e-03
Astrocytoma, Pilocytic -3.500 9.4e-12
atypical teratoid / rhabdoid tumor -3.800 1.5e-13
ependymoma -3.500 2.3e-03
glioblastoma -3.200 1.4e-10
group 3 medulloblastoma -1.300 4.1e-02
lung carcinoma 1.200 2.6e-25
medulloblastoma, large-cell -2.900 2.3e-06
oligodendroglioma -2.400 1.1e-02
Pick disease -1.100 3.8e-03
primitive neuroectodermal tumor -2.800 3.5e-05
subependymal giant cell astrocytoma -1.627 3.7e-02

Synonym

Accession Q9BR01 B2R7N3 O43728 ST4A1
Symbols NST
BRSTL1
SULTX3
BR-STL-1
DJ388M5.3
hBR-STL-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (13)

AA Sequence

MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQ      1 - 70
GADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVV     71 - 140
SYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQL    141 - 210
ARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTF    211 - 280
DFYL                                                                      281 - 284
//

Text Mined References (27)

PMID Year Title