Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.66
PubTator Score 1.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 733 0.0 0.0

Expression

Synonym

Accession Q9BQY9 Q331S6 Q5QPV4 Q5QPV6 Q9BQZ0 Q9BVL1 Q9H1F6 Q9NWZ0 Q9NY07 Q9NZ31
Symbols CK1BP
HSMNP1
C20orf35

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MGAGNFLTALEVPVAALAGAASDRRASCERVSPPPPLPHFRLPPLPRSRLPGPVSRPEPGAPLLGCWLQW      1 - 70
GAPSPGPLCLLFRLCSCTCFAPLPAGADMDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHL     71 - 140
ESQRPPIGSISSMEVNVDTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTT    141 - 210
SRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS                         211 - 259
//

Text Mined References (17)

PMID Year Title