Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.66
PubTator Score 1.37

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BQY9 Q331S6 Q5QPV4 Q5QPV6 Q9BQZ0 Q9BVL1 Q9H1F6 Q9NWZ0 Q9NY07 Q9NZ31
Symbols CK1BP
HSMNP1
C20orf35

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
16618118 CK1BP is an isoform-selective binding partner of human casein kinase-1

AA Sequence

MGAGNFLTALEVPVAALAGAASDRRASCERVSPPPPLPHFRLPPLPRSRLPGPVSRPEPGAPLLGCWLQW      1 - 70
GAPSPGPLCLLFRLCSCTCFAPLPAGADMDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHL     71 - 140
ESQRPPIGSISSMEVNVDTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTT    141 - 210
SRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS                         211 - 259
//

Text Mined References (17)

PMID Year Title
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16618118 2006 Dysbindin structural homologue CK1BP is an isoform-selective binding partner of human casein kinase-1.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
16305340 2005 The human orthologue of a novel apoptosis response gene induced during rat myelomonocytic stem cell apoptosis maps to 20q13.12.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...